(data stored in ACNUC7421 zone)

EMBL: CP001743.PE657

CP001743.PE657       Location/Qualifiers
FT   CDS_pept        651560..652576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0672"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:S-adenosylmethionine/tRNA-ribosyltransferas
FT                   e-isomerase; PFAM: Queuosine biosynthesis protein; InterPro
FT                   IPR003699; KEGG: pca:Pcar_1895 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase; COGs: COG0809
FT                   S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
FT                   (queuine synthetase); SPTR: Q5SMH0
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; TIGRFAM:
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27439"
FT                   /protein_id="ADD27439.1"
FT                   /translation="MNLEDFDYHLPPELIAQSGAEPRDASRLMVIDRQTGQITHRIFRD
FT                   LPQYLRAGDVLVLNQSKVIPARTFATNPHGTGLEVLLVREIPSGEGLWEALLKPARRAK
FT                   VGSRLTFPDGLFATVEAIEADGTRLLRFSGNVWEHLENIGKMPLPPYIQASVDPARYQT
FT                   VYAKTPGSVAAPTAGLHFTPELLDRVRGLGVDIQYVTLHVGPGTFKPVHDDPDRHVMHL
FT                   EPYEVSPQTAEAVNRARAEGRRVIAVGTTVVRTLETAYSAELGGVQAGAGETQLFIRPG
FT                   FKYNVIDTLITNFHLPKSTLLMLVSAFMGHGLMKQAYQTAVAERYRFYSLGDAMLIL"
     atgaacctcg aggacttcga ctaccaccta ccccccgaac tcatcgccca gagcggggcc        60
     gagccccgcg acgcctcgcg gctgatggtg attgaccgcc agaccggcca gattacccac       120
     cgcatcttcc gcgacctgcc ccagtacctt cgggcagggg atgtgctggt gctcaaccag       180
     agcaaggtga ttccggcccg cacctttgcc accaacccac acggaacggg gctcgaggtg       240
     ctgctggtac gagaaattcc ctctggcgag gggctctggg aggccctgct caagccggcc       300
     aggcgggcta aggtgggctc gaggctgacc tttcccgatg ggctcttcgc caccgtggag       360
     gccatcgaag cagacggaac ccggttgctc aggttttccg gtaatgtctg ggaacacctg       420
     gaaaacatcg gaaagatgcc gctgccgccc tacattcagg cctcggtaga tccggcccgc       480
     taccagaccg tgtacgccaa aacccccggc tcggtggccg cgcccacggc ggggctgcac       540
     ttcacccccg aactgctgga cagggtgcgg gggctggggg tggatattca atacgtcacc       600
     ctgcacgtgg gccccggcac cttcaagccc gtccacgacg accccgaccg gcacgtgatg       660
     catttggagc cctatgaagt ttcgccccag accgccgagg cggtcaaccg tgccagggcc       720
     gaggggcggc gggtgattgc ggtgggcacc acggtggtgc gcacgctcga gaccgcctat       780
     agcgccgagc tggggggtgt ccaggcgggg gccggcgaga cccaactgtt catccgcccg       840
     gggttcaagt acaacgtgat agacacgctg attaccaact ttcacctacc caaatccacc       900
     ctgctgatgc tggtatcggc ctttatgggg cacgggttga tgaaacaggc ctaccagacc       960
     gcggtagccg aacgctaccg gttttatagc ctgggcgacg ccatgctgat tctttag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page