(data stored in ACNUC7421 zone)

EMBL: CP001743.PE658

CP001743.PE658       Location/Qualifiers
FT   CDS_pept        complement(652614..653162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0673"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; InterPro
FT                   IPR001451:IPR005881; KEGG: pae:PA3816 O-acetylserine
FT                   synthase; COGs: COG1045 Serine acetyltransferase; SPTR:
FT                   A3LER7 O-acetylserine synthase; PFAM: Bacterial transferase
FT                   hexapeptide (three repeats); TIGRFAM: serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27440"
FT                   /protein_id="ADD27440.1"
FT                   /translation="MLRVIERFREDIQAVLERDPAARGPLEAFLFSPGMHALWMHRLNH
FT                   WLWRANFKLLARILAHFTRMFTGVEIHPGARIGRRVVIDHGMGIVIGETAEVGDDVLMY
FT                   HGVTLGGTGFTREKRHPTIGKGVLLGAHAVVLGPIVVGDGAKIGAGAVVTKPVPPGATA
FT                   IGNPAQIIVREEALEAAPA"
     atgctgcgag tcatcgaacg ttttagagaa gatatacagg ctgtgctcga acgagatccg        60
     gcggctcgag ggcctctcga ggcttttttg tttagcccag ggatgcacgc cttgtggatg       120
     caccggctca accactggct ctggcgggcc aacttcaagc tactggcccg cattctggcc       180
     cactttaccc gtatgttcac gggggtcgag attcaccccg gggcccgcat tggccgccgg       240
     gtggtgattg accacggcat gggcattgta attggcgaga ccgccgaggt gggcgacgat       300
     gtgctgatgt accacggggt gaccctgggc ggcaccggct tcacccgtga gaagcgccac       360
     cccaccattg gcaagggggt gctgctaggg gctcatgcgg tggtgctggg gcctattgtg       420
     gtgggcgatg gggccaagat aggggccggg gcggtggtca ccaagcccgt gccccccggc       480
     gcaaccgcca tcgggaaccc ggcgcagatt atcgttcggg aagaggcgct cgaggccgcc       540
     ccagcttaa                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page