(data stored in ACNUC7421 zone)

EMBL: CP001743.PE661

CP001743.PE661       Location/Qualifiers
FT   CDS_pept        655528..656745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0676"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; InterPro IPR005151:IPR001478;
FT                   KEGG: sus:Acid_6221 carboxyl-terminal protease; COGs:
FT                   COG0793 Periplasmic protease; SPTR: A7CAG4
FT                   Carboxyl-terminal protease; PFAM: Peptidase family S41"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27443"
FT                   /protein_id="ADD27443.1"
FT                   /translation="MAAFALVGSAVASPAQDLFDQATFLIGFYYNGPAKVPPFRELRRQ
FT                   YQPELDRLCASEGNRCGFDKAKQVIERIVRDIADPFTVLVTRDQLIDDERYGAGLGPAA
FT                   PRIGVWVRETPRGLVVSEAFPGEPAYEAGLRRGDLITQVADQPATLARLSAAEAARNPF
FT                   SLRYSRQGAARSLTLTPRVAGATMQPRLEINNNIAYLRVYHLYSSDSYSTAQRIHEAAR
FT                   RAEQAGARGMVIDLRDALTGYDSEALLAAAAFTGTGGFIYDRRFQGLDETHTVENGKLY
FT                   VQPEGAEKEEQSALERPYLARIPVVVLVNRHTYNSAEMLAYFLQAAGRAKVVGEPTAGA
FT                   LGMSGSAEGPLINGDFIAVSSLRMRNLDGSPFPLKVSPDVVVEDDLEALVAGRDPVLER
FT                   ALEMLR"
     atggcagcct tcgcgctggt cggttcagcg gtggcttcgc ccgcccagga tcttttcgac        60
     caggccactt tcctgatcgg cttttactac aacggcccgg ccaaggttcc ccccttcagg       120
     gaactgcggc ggcagtacca gccggaactc gaccggctct gcgcttccga aggcaaccgc       180
     tgcggctttg ataaagcaaa acaggttatc gagcgcattg tgcgggatat tgccgatccg       240
     tttacggtct tggtcactcg agaccagctc attgatgacg agcgctatgg ggctggcctg       300
     gggcctgcgg cccccaggat aggggtctgg gtacgcgaga cccccagggg gctggtggtg       360
     agcgaggcct tccccggtga gccggcctat gaggcggggc tgcgccgggg cgacctgatt       420
     acccaggtgg cagaccagcc tgcaaccctg gcccggctga gtgcggctga agcagcccgc       480
     aaccccttta gcctgcgtta tagccggcag ggtgcggccc gcagcctgac cctgacccca       540
     cgggtggccg gggccaccat gcaacccagg ctggagatca acaacaacat tgcctatcta       600
     cgcgtctatc acctgtatag ctcggacagc tactccaccg cccagcgcat ccacgaggcc       660
     gcgcgccggg ccgagcaggc cggggcccgt gggatggtga tcgatctgcg cgatgccctg       720
     accggttacg actcggaagc cctgctggcg gcggcggcct ttaccggtac agggggcttt       780
     atctacgacc gccgcttcca ggggctggac gagacccaca ccgtggaaaa cggcaagcta       840
     tacgtgcaac ccgagggagc cgaaaaggag gagcaaagtg ccctcgagcg gccttacctg       900
     gcccgcatcc cggtggtggt gctggttaac cgccatacct ataactccgc cgaaatgctg       960
     gcctacttcc tgcaggccgc gggtcgggcc aaggtggtgg gagagcccac cgccggtgcc      1020
     ctggggatgt cgggcagcgc cgagggcccc cttatcaacg gcgattttat tgcggtttct      1080
     tcgcttagaa tgcgcaacct ggatggctcg cccttccccc tcaaagtcag tcccgatgtg      1140
     gtggtggagg acgacctcga ggcccttgtt gccggacgcg atccggtgct ggagcgcgcc      1200
     ctggaaatgc tgcgatag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page