(data stored in ACNUC7421 zone)

EMBL: CP001743.PE662

CP001743.PE662       Location/Qualifiers
FT   CDS_pept        656755..658035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0677"
FT                   /product="peptidase S41"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR001478:IPR005151; KEGG: mca:MCA2533 carboxyl-terminal
FT                   protease; SMART: PDZ/DHR/GLGF domain protein; peptidase
FT                   S41; SPTR: A4CSB8 Putative uncharacterized protein; PFAM:
FT                   peptidase S41; PDZ/DHR/GLGF domain protein; PFAM: PDZ
FT                   domain (Also known as DHR or GLGF); Peptidase family S41;
FT                   TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27444"
FT                   /protein_id="ADD27444.1"
FT                   /translation="MRQLFATLALLLGSFSLASPAQDLFDQASFYLEFYYNGPATLNLK
FT                   ELTARYQSALDRACAPQKDTCPYEQAVPIIEQMLGELNDNHTYYLSPEELRGSRESRQG
FT                   NAPSRTLRIGVSHLPVPGSRDRLIVDVVEGGPADEAGLAYGDRIIAINGRLLSEFPDDN
FT                   QVVQFLTQSVQSGRPVVLTILRGPERQRLEITLTGREINLARFPSLKIRPDGVGVLKIP
FT                   NFDAQGQVGRRVHELVREAQQKNVRALVLELRGNSGGLLNEMILAAAAFLDDAYVALVD
FT                   RYQTERAEFRIRDGRLTIIRNGQTESANLPFLARWRGPLVVLVDGNTASGGEYLASAIQ
FT                   RAKVGPLVGVATLGIGNTTTRPFNLINGGALSISYNRAFFADGTPYPPRAIPDFVVESS
FT                   LEQLANTGRDLPFEKALEALGIKSAGR"
     atgcgccaac tgtttgccac cctggccctg ctgctgggct cgttttcgct ggcctcgccg        60
     gcccaagacc tcttcgacca ggccagcttc tatctggagt tttattacaa cggcccggcc       120
     acgctcaacc tcaaagagct gacggcccgc taccagagcg cactcgatcg cgcctgtgct       180
     ccccagaaag atacctgccc ctacgagcaa gccgtgccca tcatcgagca gatgctgggg       240
     gaactcaacg acaaccacac ctattatctg agccccgagg aattgcgggg ctcccgtgaa       300
     agccgtcagg gcaacgcccc ttcccgcacg ctgcgcattg gtgtcagcca cctgcccgta       360
     cctggttccc gcgatcgcct cattgtggat gtggtggaag gggggccagc cgacgaggcc       420
     ggactggcct atggcgaccg catcatcgcc attaacggtc ggcttctgag cgagttcccc       480
     gacgataacc aggtcgttca gttcctgacg cagtcggtgc agtcggggcg cccggtggtc       540
     ttaaccattc tgcgcggccc tgagcgccag cgcctcgaga tcaccctaac cggacgcgag       600
     attaatctgg cccgcttccc ctccctcaaa attaggcccg atggtgtagg ggtgctcaaa       660
     attcccaact tcgatgcgca gggccaggtg ggccgtcggg tgcatgagct ggtgcgcgag       720
     gcccagcaga aaaatgtgcg ggccttggtg ctggagttgc gtggaaacag cggtggcctg       780
     ctcaacgaga tgatactggc ggcagccgct ttcctggacg atgcttatgt ggccctggta       840
     gaccgctacc agaccgagcg cgctgagttt cgcatccgcg atgggcggct caccattatc       900
     cgcaacggcc agaccgagag cgccaacctc cccttcctgg cccgctggcg cggcccgctg       960
     gtggtgctgg ttgatggaaa caccgcttca gggggggagt acctggcctc ggccatccag      1020
     cgagccaagg tggggccgct ggttggggtg gccaccctgg gcatcggcaa taccaccacc      1080
     cggcccttca atctgatcaa cgggggggct ttgagcatct cctacaaccg ggcctttttc      1140
     gccgatggca caccctaccc accccgggcc atcccagact ttgtggtgga gagctccctt      1200
     gagcagctag ccaacactgg gcgcgacctg ccgttcgaaa aagccctgga ggcgctgggc      1260
     ataaagtcgg ctggccgcta a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page