(data stored in ACNUC7421 zone)

EMBL: CP001743.PE665

CP001743.PE665       Location/Qualifiers
FT   CDS_pept        complement(659484..660071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0680"
FT                   /product="heme exporter protein CcmA"
FT                   /note="TIGRFAM: heme exporter protein CcmA; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; InterPro
FT                   IPR003439:IPR003593:IPR005895; KEGG: sme:SMa1184 NosF
FT                   ATPase; COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; SPTR: A6GFN6 Putative uncharacterized
FT                   protein; PFAM: ABC transporter; TIGRFAM: heme ABC exporter,
FT                   ATP-binding protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27447"
FT                   /protein_id="ADD27447.1"
FT                   /translation="MVCSMLIEAIAVSKRYGRDWVLRNLDFQLAQHEAVALVGPNGVGK
FT                   TTLLRVLAGLVRPTQGSVKLSGRVGFLANPPAFHRHFTGAENLHYALRLDGKTGGRSEI
FT                   RAALTQFGLPHDKPVLSYSSGMKKRLAMARLHLQNPDIWLLDEPEAALDAQGRGLLENL
FT                   VQQARSRGGVVIATHDKSWLSLVDRIVELQGP"
     atggtatgtt ctatgcttat cgaagccata gccgtttcca aacgttacgg gcgggactgg        60
     gtgctgcgca acctggattt tcaactggct caacacgaag ccgtcgccct ggtaggcccc       120
     aacggcgtgg gcaaaaccac cctgttgcgg gtgctggctg ggttggtgcg tcccacccag       180
     ggttcggtca agctaagcgg aagggtgggc ttcttggcta atccaccggc tttccaccgg       240
     cactttaccg gagctgaaaa cctgcactac gcacttcggc tcgatggaaa aaccggtggt       300
     cgcagtgaaa ttcgggccgc gctgacccaa tttgggcttc cacacgacaa gcctgtcctg       360
     agctacagca gcggcatgaa aaagcgcctg gccatggccc gattgcacct gcaaaatccc       420
     gatatctggc tactggacga gcccgaagct gccctagacg cacaagggcg gggcttgctg       480
     gaaaacctgg tacagcaggc gcgctccagg ggtggtgtgg tgattgccac acacgacaaa       540
     agctggcttt ccctggtaga ccggatagtt gagctacaag gcccgtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page