(data stored in ACNUC7421 zone)

EMBL: CP001743.PE667

CP001743.PE667       Location/Qualifiers
FT   CDS_pept        660835..661848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0682"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: pmy:Pmen_1328
FT                   ABC transporter related; COGs: COG3842 ABC-type
FT                   spermidine/putrescine transport systems ATPase components;
FT                   SPTR: Q8U0R5 Sugar-binding transport ATP-binding protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27449"
FT                   /protein_id="ADD27449.1"
FT                   /translation="MLRVIGLGKSYPGFRLQVSLEVGVGQTLALLGPSGSGKSTLLRLI
FT                   AGLEAPEVGQVWLEQTELTPLAPEARRVGFVFQDYALFPHLSVWENIAFGLREARWDGA
FT                   SIRRRVAELLDLTHLGPHAQKRPNQLSGGERQRVALARALANRPRLLLLDEPLGALDLK
FT                   LRHELLWELRAILRQAGVPTIVVTHDQSEAFVIAQQIALLRGGAVVQVGSPEQLFRHPK
FT                   NAWVAGFLGHRNLLSADQSQQMGLPARPHLLPPEAITLGQGEEARVEERVFKGFVVGLE
FT                   LLWRGCKLYLEGPELGLYPGDTTQLGIDWSRVVALEEEPSSTPGAAQPSLEAPRAR"
     atgttgcggg tgatagggct cggcaaaagc tatccggggt tccggctgca ggtctccctc        60
     gaggtcggcg tggggcaaac cctggccttg ctggggcctt cgggcagcgg taagagcacg       120
     cttttgcggc tgatagcggg tttggaggca ccggaggtcg gtcaggtctg gctggagcag       180
     accgaactca cccccctggc gccggaagcg cgccgggtgg ggtttgtgtt tcaggattat       240
     gccctgtttc cacacctatc ggtctgggaa aacattgcct ttggcctgcg ggaggcccgc       300
     tgggatggcg caagcatacg gcggcgtgtg gccgaactgc tggatttgac ccatttaggg       360
     ccccacgcgc aaaaacgtcc caaccagctt tcgggcggtg agcgccagcg ggtggccctg       420
     gctcgagccc tggccaaccg gccccgcctg ctgctgctgg atgagccgct gggtgctctg       480
     gatctgaagc tgcggcacga actgctgtgg gagctgcggg ccattttgcg gcaggcgggg       540
     gtgccgacca ttgtggtgac ccacgaccag tccgaggctt ttgtaatcgc ccagcagatt       600
     gccctgctga ggggaggtgc ggttgtgcag gtgggttcgc ctgagcagct ttttcgccat       660
     ccaaaaaacg cctgggtggc cggctttctg ggccaccgca acctgctgtc ggccgatcag       720
     agccagcaga tggggttgcc ggctcgcccg cacctgctgc cgccggaggc catcaccctg       780
     ggccaagggg aagaagcgcg ggtagaagag cgggttttta agggttttgt ggtgggcctc       840
     gagctgctct ggcgaggctg taagctgtac ctggagggcc cggagctggg gctgtacccc       900
     ggcgatacca cccagcttgg gatcgattgg tctagggtgg ttgcgctgga ggaggagccc       960
     tcgagtaccc cgggggctgc gcaaccctcg ctggaagctc ctcgagcccg ctag            1014
//

If you have problems or comments...

PBIL Back to PBIL home page