(data stored in ACNUC7421 zone)

EMBL: CP001743.PE668

CP001743.PE668       Location/Qualifiers
FT   CDS_pept        661862..662500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0683"
FT                   /product="thiamine pyrophosphokinase"
FT                   /note="TIGRFAM: thiamine pyrophosphokinase; PFAM: Thiamin
FT                   pyrophosphokinase catalytic region; InterPro
FT                   IPR007371:IPR006282; KEGG: ret:RHE_CH04030 hypothetical
FT                   protein; COGs: COG1564 Thiamine pyrophosphokinase; SPTR:
FT                   A8RWT7 Putative uncharacterized protein; PFAM: Thiamin
FT                   pyrophosphokinase, catalytic domain; TIGRFAM: thiamine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27450"
FT                   /protein_id="ADD27450.1"
FT                   /translation="MQRFTILLGGLVTPTERLKAQVAGSRVIAADGGMRHAQALGLQAE
FT                   LWVGDFDSAPAELQQAYAQVPRETYPVAKDFTDGELAIEAALARGAAQLVLVGAMGGQT
FT                   DQTLAHLLLGIRLAQQGVPTLLTSGSEEAHPLLPGALRLDLPLHSKLSLLPLGGFSGLS
FT                   LRGVRWPLQKASIPLGSTQTLSNLAVGPVEIELEAGYGVVVAYPEPATL"
     atgcaacgct tcaccattct gctaggcggt ctggttaccc cgaccgagcg gctcaaggcc        60
     caggtggccg ggagtcgggt tattgctgcg gatggcggta tgcgccacgc ccaagccctg       120
     gggcttcagg ccgagctgtg ggtaggcgat ttcgactcgg ccccggcgga actccagcag       180
     gcctatgccc aggtgccgcg cgaaacctat ccggtggcca aggacttcac cgacggtgag       240
     ctggccatcg aggctgccct ggcccggggg gcggcacagc ttgttctggt gggggccatg       300
     gggggtcaga ccgaccagac cctggcccac ctgctgctgg gtatccggct ggctcagcag       360
     ggggtgccga ccctgctaac ctcgggcagc gaggaggccc accctttatt gcctggagcc       420
     ctgcggctgg acttacccct ccacagcaag ctgagcttgc taccgctggg tggtttttcc       480
     ggcctgagtc tgcgtggggt gcgctggccg ctacaaaaag ccagcatacc gttgggaagt       540
     acccagaccc tttccaacct ggctgtaggc ccggtggaga tcgaactcga ggctggctac       600
     ggggtggtgg tggcctaccc tgagccggca accttgtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page