(data stored in ACNUC7421 zone)

EMBL: CP001743.PE669

CP001743.PE669       Location/Qualifiers
FT   CDS_pept        complement(662476..662973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27451"
FT                   /protein_id="ADD27451.1"
FT                   /translation="MDPFREYQDYVIAHRLREALDFFPGKLYSLCEYATLRLRRSELVR
FT                   KLVGRQGDPALLSRIEQISDEINFGFWSNPGLLKAFLKRLPPQQYPVLHSPEAFETLLS
FT                   HTERLRLKEPGLAGRYYLGWLRLPALLDEPSAFEQAMLEQEHLAEALGLFLDEFHKVAG
FT                   SG"
     gtggatccct tcagggaata ccaggactac gtcattgcgc accgcctgcg cgaggccctg        60
     gacttcttcc ccggcaagct ctactcgctg tgcgagtatg ccaccttgcg ccttcgccgc       120
     agtgagctgg tgcgcaagct ggtaggccgt cagggtgatc ctgcgctttt atcgcgcatc       180
     gaacaaatct ccgacgagat taattttggc ttctggtcca accccggcct gctcaaagct       240
     ttcctgaagc gtttaccccc gcaacaatac cccgtgctgc acagccctga ggccttcgaa       300
     acccttctct cgcacaccga gcggcttcgg ctcaaggaac cgggtctggc cgggcgctac       360
     tacctggggt ggctgcgcct gcccgccctg ctggatgaac cctcggcatt tgagcaggcc       420
     atgctcgagc aagaacacct ggcggaagcc ctggggctgt tcctggacga atttcacaag       480
     gttgccggct cagggtag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page