(data stored in ACNUC7421 zone)

EMBL: CP001743.PE670

CP001743.PE670       Location/Qualifiers
FT   CDS_pept        663004..663318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27452"
FT                   /protein_id="ADD27452.1"
FT                   /translation="MKEATAEKIPLLWWGLHPFWVTDAVYSGMDTRGWVLKAIETLRFA
FT                   SEKDIMRWLDEEGETLSKDELRRTLELLLQEDQLELKNDLFRLKRKSGSQSAFDSLFKD
FT                   "
     atgaaagaag ccaccgcaga gaaaataccg cttctttggt gggggcttca cccattctgg        60
     gttaccgacg cggtatattc aggtatggat acccggggtt gggtgctcaa agccatcgag       120
     acgctgcgct ttgccagcga aaaggacatt atgcgttggc tggacgagga gggtgagacc       180
     ctgtccaaag acgagcttcg acgcaccctc gagctgctgc tgcaggaaga ccagctcgag       240
     ctcaaaaacg atctcttccg cctcaagcgc aaaagcggca gtcaatcggc tttcgatagc       300
     ctgttcaagg actga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page