(data stored in ACNUC7421 zone)

EMBL: CP001743.PE671

CP001743.PE671       Location/Qualifiers
FT   CDS_pept        663366..664541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0686"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; peptidase M20; SPTR: A2V759 Aminopeptidase;
FT                   InterPro IPR003137:IPR007484:IPR002933; COGs: COG2234
FT                   aminopeptidase; KEGG: bha:BH3861 aminopeptidase; PFAM:
FT                   Peptidase family M20/M25/M40; PA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27453"
FT                   /protein_id="ADD27453.1"
FT                   /translation="MGRQLFLRGALGLVAIGLLALAQAFSTERMQADLQALLSQGPRVA
FT                   GLPATTAAGEYLAAELRKVGYTVEFQPFTYSRTRDQGSSLLVGTTSFPVSSVAGSPGRR
FT                   VEGPLAVVPGAGLAADFADLNLQGAIAVVRRGGIPGLEKARLAAERGAVGLILLTEEPS
FT                   GTRFTFGGNSPIPGVTLSQSDGAGLFSQAGTRAVLDVRIVTEEVQGRNVIARRSSQNPL
FT                   VIVGAHYDSVPGSPGANDNASGTVTVLELARQLADSPLAAQIWFLFFDGEEDGLWGSRR
FT                   FVEQNPEIVRGLKGMLNLDMVGVNVNGTLGIGGSGELRALADCNALQVACGSAPGGGSD
FT                   HVPFAQAGVPVLFFFRGLDPNYHRPTDTLADPVLMAQTGQVVRGILERLLR"
     atgggccgac aattgttttt gcgtggggcc ctggggctgg tggccatcgg gctgctggcc        60
     ctggcccagg ctttttctac cgagcgcatg caggccgatc tgcaggccct gctgtcacag       120
     gggccgcggg tcgcgggcct gcccgccacc actgccgctg gagaatacct ggccgccgag       180
     ctgcgcaagg tgggctacac ggtggaattc cagcccttca cctacagccg cacccgcgac       240
     cagggctcga gccttttggt ggggacgacc agctttccgg tgagcagcgt ggcgggcagc       300
     ccgggccgac gggtggaggg gccgctggca gtggtgcccg gggcggggct ggccgccgac       360
     ttcgccgacc tgaacctgca gggcgccatt gcggtggtgc gccggggagg gattcccggc       420
     ctcgagaagg cccggctggc tgccgagcgg ggggctgtgg gccttatcct gctgaccgag       480
     gagcccagcg gtacccgctt cacctttggc ggcaatagcc ccattccggg ggtgaccctc       540
     tcgcagagtg atggcgctgg gctcttcagc caggcgggaa cccgcgccgt gctggacgtg       600
     cgcatcgtga ccgaggaggt acaggggcgc aacgtgatcg ccaggcgcag cagccagaat       660
     ccgctggtga ttgtgggggc ccactacgac tcggttccgg gcagcccagg ggccaacgac       720
     aacgcctcgg gcaccgtcac ggtgctcgag ctggcccgcc aactggccga cagccccctc       780
     gcagcgcaga tctggttcct gtttttcgac ggggaagagg acgggttgtg gggctcgcgc       840
     cggtttgttg aacagaaccc cgaaattgtg cggggcctga agggcatgct caacctggac       900
     atggtgggcg tcaacgtgaa tggcaccctg ggcatcggcg gaagcggtga attgcgggcg       960
     ctggccgact gcaacgccct gcaggtggcc tgtggcagcg cgccgggtgg gggcagcgac      1020
     cacgtgccct ttgcccaggc cggggtgccg gtgctcttct tcttccgcgg cctcgacccc      1080
     aactaccacc gccccaccga caccttggcc gaccccgtgc tgatggccca gaccggccag      1140
     gtggtgcggg ggattctgga aaggctgctg cgctag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page