(data stored in ACNUC7421 zone)

EMBL: CP001743.PE672

CP001743.PE672       Location/Qualifiers
FT   CDS_pept        complement(664548..665462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0687"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; SPTR: B3LQP1 Putative uncharacterized protein;
FT                   InterPro IPR001926:IPR000634; COGs: COG1171 Threonine
FT                   dehydratase; KEGG: aav:Aave_3217
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27454"
FT                   /protein_id="ADD27454.1"
FT                   /translation="MLTLQDIQHAAQRIAPYIHHTPVLSSQGLDKLLGRRFFFKAEHLQ
FT                   KTGSFKARGALNAALQLQNPRGLIAVSSGNHAQGVAYAAQVIGAPALVVMPEDASPTKK
FT                   AATRAYGAEVYDQGVTVENREQVVRALAEETGYALIHPFDDLRVMAGQGTQALELLQQV
FT                   PDLDAVLVAVGGGGLISGIATVIKSLRPACEVIGVEPETANDAQQSLQMGARVKLVQAP
FT                   RTVADGVRTLAVGEKTFPVMQRHVDRIVTVPDEVTLEAQRLMMQRLKQVVEPTAGLALG
FT                   PALMSYDLPERVAVIVCGGNWMP"
     gtgctaaccc tgcaagatat ccaacatgcc gcccaacgca ttgcccccta catccaccac        60
     accccagtgc tgagcagcca gggactggat aagcttctgg gccgccggtt ctttttcaag       120
     gccgagcacc tgcaaaaaac cggcagcttc aaagcccggg gtgccctgaa cgcggctctt       180
     cagctacaaa acccccgggg cctgattgcg gtctcgtcgg gcaaccacgc ccagggggtg       240
     gcctatgcgg ctcaggtgat cggggcgccg gccctggtgg tgatgccgga ggatgcctcc       300
     cccaccaaaa aagcggccac ccgggcctac ggcgccgagg tctacgacca gggggtgacg       360
     gtagagaacc gcgagcaggt ggtgcgcgca ctggccgagg agacgggcta tgcgctcatc       420
     caccctttcg acgacttgcg ggtgatggca ggccagggca cccaggccct ggaactcttg       480
     cagcaggtgc ccgatctgga cgccgtcctg gtcgcggtgg gcgggggcgg gctcatctcg       540
     ggcatcgcca cagttatcaa gagcctgcgg cccgcgtgtg aggtgattgg ggtggagccc       600
     gaaaccgcca acgatgccca gcagagcctc cagatggggg cgcgcgtgaa gctggtgcag       660
     gcccccagaa ccgtggccga tggggtgcgc accctggcgg ttggcgagaa gacctttccg       720
     gtcatgcagc gccatgtgga tcgcattgtg acggtgccgg acgaggttac cttggaagcc       780
     cagcgcctga tgatgcaacg gctcaaacag gtggtggagc ccaccgccgg gctggctttg       840
     gggccggcct tgatgagcta cgacctaccc gagcgggtag cagtaattgt atgcggtggg       900
     aactggatgc cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page