(data stored in ACNUC7421 zone)

EMBL: CP001743.PE678

CP001743.PE678       Location/Qualifiers
FT   CDS_pept        complement(668917..669348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0693"
FT                   /product="protein of unknown function DUF151"
FT                   /note="InterPro IPR003729; PFAM: protein of unknown
FT                   function DUF151; COGs: COG1259 conserved hypothetical
FT                   protein; KEGG: dvu:DVU0983 hypothetical protein; SPTR:
FT                   A0YTA3 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27460"
FT                   /protein_id="ADD27460.1"
FT                   /translation="MVPARIEGMGVDPGNGNLIVMLRAENDLLLPVVIGALETQNIMVH
FT                   LSGEKPPRPLGPDLFYNTLELLGVKVLRLEIAELKEGTFYGRLILEQRGLEYEIDCRPS
FT                   DGMALAIRAGAPILIAEQVLEQAGIKESQLNRRGEPPKA"
     atggtacccg cacgcatcga aggaatgggg gtagatccag gaaatggcaa cctgatcgtg        60
     atgctcaggg ccgagaacga tctgctcctg ccggtggtga tcggggcctt ggaaacccag       120
     aacatcatgg tgcacctctc gggcgagaaa cccccccgcc cgctgggccc cgacctgttc       180
     tacaacaccc tcgagctgct aggggtaaag gtgctgcgcc ttgagatcgc cgaactgaaa       240
     gaaggtactt tctacggccg tctcatactg gaacagcgcg gcctggagta tgagatcgac       300
     tgccgccctt ccgacggcat ggccctggcc atccgcgccg gggcccccat cctgattgcc       360
     gagcaggtgc tcgagcaggc cggcattaaa gaatcgcagc taaaccgtcg gggagagccg       420
     cccaaggcat ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page