(data stored in ACNUC7421 zone)

EMBL: CP001743.PE68

CP001743.PE68        Location/Qualifiers
FT   CDS_pept        57630..57875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26850"
FT                   /protein_id="ADD26850.1"
FT                   /translation="MISLDTNVIFSALNKAGVHHDRARQLLKKYGALVLSPVVHAELMA
FT                   SSDAPGIQLFLQKAQISTLWEVPPAVWEAAGRGFGQ"
     atgattagcc tggacaccaa cgtgatattt tcggcgctca acaaggcggg tgtccaccac        60
     gaccgcgccc ggcagctcct gaaaaagtat ggggcgctgg ttctctcgcc ggtggtacac       120
     gccgagctga tggcctcgag cgatgcgccg ggcatccaac ttttcctgca gaaagcccag       180
     atatctaccc tctgggaggt gccgcccgcg gtgtgggaag cggcgggtag gggctttgga       240
     cagtag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page