(data stored in ACNUC7421 zone)

EMBL: CP001743.PE680

CP001743.PE680       Location/Qualifiers
FT   CDS_pept        670122..670658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0695"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; SPTR: A5TS89
FT                   Adenine phosphoribosyltransferase; InterPro IPR000836;
FT                   COGs: COG0503 Adenine/guanine phosphoribosyltransferase and
FT                   related PRPP-binding protein; KEGG: dps:DP1516 adenine
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27462"
FT                   /protein_id="ADD27462.1"
FT                   /translation="METYPITIGKITRHVPVVETLPGVHIPLVEIMGDVELVQAAAEGL
FT                   VKHLPPETDALLTLETSPIVLAHTMSALCGKPYVVVRRKRRPYMQDPIIQEVESLTLGV
FT                   TETLWLDSRMAEKLMGQNVALVFDVVSSGGTMNALEKVAKKAGANVVARLAAFHQGNSK
FT                   LPITFLSEIPILQTA"
     atggaaacct atcccatcac aataggcaaa atcacccgtc atgtaccggt ggttgaaacc        60
     ctgccgggcg ttcacatccc cctggttgag attatgggcg atgtggagct ggtgcaggcc       120
     gccgccgaag ggctggtcaa gcacctgccc cccgagaccg atgccctgct gaccctcgag       180
     acctccccca tcgtgctggc ccataccatg agcgccctct gcggcaagcc ctatgtggtg       240
     gtgcgccgta agcgccgccc ctacatgcaa gaccccatta tccaggaggt ggagtcgctg       300
     accctgggcg taaccgagac cctctggctg gacagccgca tggccgaaaa gctgatgggc       360
     cagaatgtgg ccctggtctt cgacgtggtc tcctcggggg gcaccatgaa cgcgctcgag       420
     aaagtggcca agaaggccgg ggccaacgtg gtggcccgcc tggctgcttt ccaccagggc       480
     aacagcaagc tgcccatcac cttcctctcg gagatcccca tcctgcaaac cgcttag          537
//

If you have problems or comments...

PBIL Back to PBIL home page