(data stored in ACNUC7421 zone)

EMBL: CP001743.PE682

CP001743.PE682       Location/Qualifiers
FT   CDS_pept        complement(671406..671810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0697"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; SPTR: A3LF67
FT                   Putative uncharacterized protein; InterPro
FT                   IPR006683:IPR003736; COGs: COG2050 Uncharacterized protein
FT                   possibly involved in aromatic compounds catabolism; KEGG:
FT                   pap:PSPA7_1137 hypothetical protein; PFAM: Thioesterase
FT                   superfamily; TIGRFAM: uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27464"
FT                   /protein_id="ADD27464.1"
FT                   /translation="MHPSNLEEIQRLYTQAHFVQHIGLRLLDVGEGWCETAVDIQAHHQ
FT                   QQDGFIHAGVQATMADHSAGTAAATLIKPGQYVLTVEFKINLLRPAQGELLRCRAEVLK
FT                   PGRSLCVVESVVFAEKLFSKATVTLAVLDR"
     atgcatccga gcaacctcga ggagatccag cgcctctaca cccaggccca ctttgttcag        60
     cacatcggcc tgaggctgct tgacgtgggt gagggctggt gcgagacggc ggtggacatc       120
     caggcacacc accaacagca agatggcttc atccacgccg gcgtacaggc caccatggcc       180
     gaccacagcg ccggaaccgc cgccgcaacg ctgattaagc ctggtcagta tgtgctcacc       240
     gtggagttca agatcaacct gctacgacct gcccagggcg agctcctacg ctgccgggcc       300
     gaggtgctga agccgggccg ctccttgtgc gtggtggagt ctgtggtgtt tgccgagaag       360
     ctcttttcta aagcgacagt aaccttggcg gtactggata ggtaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page