(data stored in ACNUC7421 zone)

EMBL: CP001743.PE71

CP001743.PE71        Location/Qualifiers
FT   CDS_pept        complement(59993..61099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0072"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: A3TR96
FT                   Putative L,L-Cystathionine gamma-Lyase; InterPro IPR000277;
FT                   COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; KEGG: pol:Bpro_2831 cystathionine
FT                   gamma-lyase; PFAM: Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26853"
FT                   /protein_id="ADD26853.1"
FT                   /translation="MDKPSRLRPASWLVAAGRPTAPGEPLNTPLVPASNFILGQERAYA
FT                   RDGGTPTWEALEALVGGLEDGKAVAFASGMAAVAAVFDQLPVGALVVLPDDCYQGVVGL
FT                   ALAGAEKKRWSVRRLALEDTEGWVRACGEADLIWLESPSNPLLTVVDLAAIGQAPRKPG
FT                   AILAVDNTFATPLNQQPLAFGATVSIQSATKFIGGHSDLLGGVATTRDEALWQALRKSR
FT                   ELSGATPGTLEAFLAVRGARTLALRLQKAQENAQTLALRLEQHPRVARVRYPGLPSHPT
FT                   HATARRVLKGFGSIISFELHGGAAEADAVCRRVRLIRHATSLGGVESTMERRAAIPGQE
FT                   HLPPSLLRLSVGIEDVEDLWADLEAALQ"
     atggacaagc cttcccgact cagaccggcc tcctggctgg tggccgctgg ccgcccaacc        60
     gcgcccggcg aacccctcaa taccccgctg gttccggcct ccaacttcat cctggggcag       120
     gaacgggcct acgcccgcga cggcggcacg cccacctggg aggccctcga ggccctggtg       180
     ggggggctcg aggatgggaa ggccgtggcc tttgcctcgg gtatggccgc ggtggcggcg       240
     gtttttgatc agcttccggt gggggcgctg gtggtgctgc cggacgactg ctaccagggg       300
     gtggtggggc tggccctggc cggagccgag aagaagcgct ggtcggtgcg tcggctggcc       360
     ctggaggaca ccgagggctg ggtgcgggcc tgtggcgagg ccgacctgat ctggctcgag       420
     tccccctcca acccgctgct cacggtggtg gatctggccg ccatcggaca ggccccgcgc       480
     aagcccggcg ccattctggc ggtggacaac acctttgcca cccccctcaa ccagcagccc       540
     ctggcgtttg gggccacggt ctccattcag tcggccacca agtttatcgg gggccactcc       600
     gacctgctcg ggggggtggc caccacccgc gacgaggctt tgtggcaggc cctgcgaaag       660
     tccagggaac tcagcggcgc cacccccggc accctcgagg ccttcctggc cgtgcggggg       720
     gcgcgcaccc tggccctccg cctgcaaaaa gcccaggaga acgcccagac gctggccctt       780
     cgcctcgagc agcacccccg ggtggcccgt gtgcgctacc caggcctccc ctcccacccc       840
     acccacgcca ccgccaggcg cgtgctgaag ggctttggca gcatcatctc cttcgagctg       900
     cacggcgggg ccgccgaggc cgacgcggtc tgtcggcgcg tccggctgat ccgccacgcc       960
     accagcctgg ggggggtgga gtctaccatg gagcgccggg cggccattcc ggggcaggag      1020
     cacctacccc cttccctgct gcggctgagc gtgggcatcg aggatgtcga ggatctctgg      1080
     gccgacctcg aggccgccct gcaataa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page