(data stored in ACNUC7421 zone)

EMBL: CP001743.PE72

CP001743.PE72        Location/Qualifiers
FT   CDS_pept        61134..61367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26854"
FT                   /protein_id="ADD26854.1"
FT                   /translation="MVQLFNADTGAPIGQISEAQLSFLVAQMEEEHAQDQDYYLNADLL
FT                   ETWREQGADPALIELLAKAMGDGEELSIRWSR"
     atggtgcaac tgttcaacgc cgataccggc gcgcccatcg gccagattag cgaggcccag        60
     ctttcgttcc tggtcgccca gatggaagag gaacacgccc aggatcagga ctactacctg       120
     aatgcggatt tactggagac ctggcgtgag cagggcgccg acccggccct catcgagctg       180
     ctggctaaag ccatggggga tggggaagaa ctgagcatcc gctggtcgag gtag             234
//

If you have problems or comments...

PBIL Back to PBIL home page