(data stored in ACNUC7421 zone)

EMBL: CP001743.PE73

CP001743.PE73        Location/Qualifiers
FT   CDS_pept        complement(61368..62000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0074"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; SPTR: A2VSV8
FT                   Phosphoglycerate/bisphosphoglycerate mutase; InterPro
FT                   IPR013078:IPR001345; COGs: COG0406 Fructose-2
FT                   6-bisphosphatase; KEGG: afr:AFE_0621 phosphoglycerate
FT                   mutase family protein; PFAM: Phosphoglycerate mutase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26855"
FT                   /protein_id="ADD26855.1"
FT                   /translation="MKELWLVRHGETPWNAEGRFQGHYDINLSPQGLHQAFRVAERLAA
FT                   CRQGFDGLYSSDLQRAALTAKPIAEALRLTPTFDPRLREIYAGELQGLLRSEMQVLYPE
FT                   FHEAIQRDPWNTKRPGGESMADLAARVQEFIEELPEGRFIVVTHGGVIRAALKIVLELE
FT                   NGSWRKFQIQNTSITRLLYPEGTALSIGDVGHLEAWAEGLMDEATLS"
     atgaaagaac tctggctggt acgccacggc gagaccccct ggaacgcgga ggggcgtttt        60
     caggggcatt acgacatcaa tctctccccg cagggcctgc accaggcctt ccgggtggcc       120
     gagcgcctgg ccgcctgccg ccagggcttc gatggcctgt acagctccga tctgcaaagg       180
     gcggccctca ccgccaagcc catcgccgag gccctgcgcc ttacacctac cttcgacccc       240
     cgcctgcgcg agatttacgc cggcgagttg caggggctgt tgcgcagcga gatgcaggtg       300
     ctctaccccg agttccacga ggccatccag cgcgacccct ggaacaccaa gcgccccggc       360
     ggcgagagca tggccgacct ggccgcgcgg gtacaggaat ttatcgagga gctaccggaa       420
     ggccggttta tcgtggtgac ccacgggggg gtgatccggg ccgcgctcaa gattgtgctc       480
     gagctggaga atggttcctg gcgcaagttt caaatccaga acacctccat cacccgtctg       540
     ctctaccccg aaggcaccgc cctctcgatt ggggatgtgg gccacctcga ggcctgggcc       600
     gaggggctga tggacgaggc cacactctcg tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page