(data stored in ACNUC7421 zone)

EMBL: CP001743.PE75

CP001743.PE75        Location/Qualifiers
FT   CDS_pept        complement(63020..64444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0076"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="SPTR: Q72H75 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit B; KEGG: afw:Anae109_4336
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B; PFAM:
FT                   GatB region; GatB/Yqey domain protein; GatB central domain
FT                   protein; InterPro IPR006075:IPR003789:IPR006107:IPR004413;
FT                   TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B subunit;
FT                   COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog); PFAM: PET112 family, C terminal
FT                   region; PET112 family, N terminal region; GatB domain;
FT                   TIGRFAM: glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26857"
FT                   /protein_id="ADD26857.1"
FT                   /translation="MPDFEAVVGLEVHLHLKTKSKMFCGCDASYFGDPPNTHTCPVCLG
FT                   LPGVLPVVNAQAVEYGILFGLALNCQIAPWTQFHRKSYYYPDMPKNYQISQYDLPIAAH
FT                   GYLEVEGQRVRIKRVHLEEDAAKSTHPEGASYSLIDLNRAGSPLIEMVTEPDIRTPEQA
FT                   RVFLSHIRSIAQTLGVSDANPEEGKMRADVNVSVRRVGEPLGTKVEIKNLNSFRSVARA
FT                   LEYEIRRQQEILRSGRRVEQATLGFDEAAGKTYVMRLKEGEADYRYFPDPDLPPIVVDE
FT                   AWLERLRAAMPELPAQKYARYVEAGVRPYDAEILAYNPSLARFFDQTLAHHQGNPQTVA
FT                   NLLNAEVAGYLNERLVEVQETALTPQHLAALAGLFERREITNRVLSQLLPEVMEGADPL
FT                   KLVEERGLRAVADEGALRPLVERVVAANPKVVEQVKGGNLKAANALLGPIMKETKGTAK
FT                   ADVVKKMLGEMLGVEL"
     atgcccgatt tcgaagccgt ggtagggctg gaagtccacc tgcacctcaa aaccaaaagc        60
     aagatgttct gcggctgcga tgccagctat tttggcgacc cgcccaacac ccacacctgc       120
     ccggtctgcc tgggcctgcc gggggtactg ccggtggtca acgcccaggc cgtggagtac       180
     ggcatcctgt tcgggctggc cctgaactgc cagattgccc cctggacgca gttccaccgc       240
     aagagctact actaccccga catgcccaaa aactaccaga tctcccagta cgacctgccc       300
     atcgcggccc acggctacct ggaggtggag gggcagcggg tgcgcatcaa gcgggtgcac       360
     ctcgaggagg acgcggccaa gtccacccac cccgaggggg cctcctattc cctgattgac       420
     ctcaaccggg ccggctcccc cctgatcgag atggtcaccg aaccggacat ccgcaccccc       480
     gagcaggccc gggtttttct ctcccacatt cgctcgatcg cccagaccct gggggtatcc       540
     gacgccaacc ccgaggaggg caagatgcgg gccgacgtga acgtctcggt gcggcgggtg       600
     ggagagccgc tcggaaccaa ggtcgagatc aagaacctga actccttccg cagcgtggcg       660
     cgggccctcg agtacgagat acggcggcag caggaaatcc tgcgcagcgg gcgcagggtc       720
     gagcaggcca ctttaggctt cgacgaggcc gccggcaaaa cctacgtgat gcgcctgaag       780
     gaaggtgagg ccgactaccg ctacttcccc gaccccgacc tgccccccat cgtggtggac       840
     gaggcctggc ttgagcggct ccgcgcggcc atgcccgagc tgcccgccca gaaatacgcc       900
     cgctacgtgg aggccggggt gcgcccctac gacgccgaaa tcctggccta caacccctcg       960
     ctggcccgct tcttcgacca aaccctggcc caccaccagg gcaaccccca gaccgtcgcc      1020
     aacctgctca acgccgaggt ggccggttat ctgaacgagc ggctggtgga agtgcaggag      1080
     actgccctca ccccccagca cctggccgcg ctggcagggc tgttcgagcg acgcgagatc      1140
     accaaccggg tcttgagcca gctactcccc gaggtgatgg aaggggccga ccccttgaag      1200
     ctggtggagg aacgcggcct gcgggcggtc gcggacgagg gcgcgctgcg gcccctggtg      1260
     gagcgggtgg tggctgccaa ccccaaggtg gtggagcagg tcaagggtgg caacctcaag      1320
     gccgccaacg ccctgctggg ccccatcatg aaggagacca agggcaccgc caaggccgac      1380
     gtggtcaaaa agatgctggg cgagatgctg ggggtcgagc tatga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page