(data stored in ACNUC7421 zone)

EMBL: CP001743.PE76

CP001743.PE76        Location/Qualifiers
FT   CDS_pept        complement(64795..65304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0077"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; InterPro
FT                   IPR008258; KEGG: zmo:ZMO1186 lytic murein transglycosylase;
FT                   SPTR: Q859R5 ORF27; PFAM: Transglycosylase SLT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26858"
FT                   /protein_id="ADD26858.1"
FT                   /translation="MEANPRLKNTSCSECGGRSLAAVVAGALAQAEGLEVPPDLVVAVA
FT                   WHESTFNPHVDRVAEALRISNNGANCASGTEIGPMQVKPCAFRTVRLDPTLLLNMPTPV
FT                   RIQYAVSAGILYLRWLKNIRLPGASWCEVLHAYNVGPGAFLAGQRNASYVQAILGKVGE
FT                   YSELRV"
     gtggaagcta acccgcgcct gaaaaatacc tcgtgcagtg agtgcggggg ccgctcgctg        60
     gcggcggtgg tggccggggc cctggcccag gccgaggggc tggaggtgcc ccccgatctg       120
     gtggtggcag tggcctggca cgagagcacc ttcaacccgc atgtagaccg ggtggcggag       180
     gccctgcgaa taagcaacaa cggggccaac tgcgcttcgg gtacggaaat tggccccatg       240
     caggtcaagc cgtgcgcgtt caggactgtg cgacttgatc caacgctcct gctcaacatg       300
     cccacgccgg tgcggattca gtacgcggtg tctgccggca ttttgtacct gcgctggctg       360
     aaaaacattc gcctgcccgg tgcatcctgg tgtgaggtgc tgcacgccta caacgtgggg       420
     ccgggggcct tcctggcggg gcagcggaat gcaagctatg tgcaggccat tctgggtaag       480
     gtgggggagt attcggagtt gagggtttag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page