(data stored in ACNUC7421 zone)

EMBL: CP001743.PE79

CP001743.PE79        Location/Qualifiers
FT   CDS_pept        complement(66368..66790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26861"
FT                   /protein_id="ADD26861.1"
FT                   /translation="MNWTDFIPSGNLWIVWLLQASLAVGVITLFAGGLIALLGKIPIVG
FT                   PILAGIVRIIAGNYERWLSERVPKLAEQVVLSVEERYRKSNLSFEERAQTKLEEAISAL
FT                   QQMAPGLGRDIAQRQVEAALSRIRATGMEQKAGGAK"
     gtgaactgga ctgactttat accatctgga aacctatgga tcgtctggct gctccaggcc        60
     agcttagccg taggcgtaat aaccttgttt gctggcggtt tgatagcgct ccttgggaag       120
     attcccatag tggggccaat cctggcgggg atcgtgcgca tcatcgccgg gaactacgag       180
     cgctggctgt cggagcgcgt tcccaaactg gccgagcagg tggtgctcag cgttgaggaa       240
     cggtatcgca aaagtaacct ttcctttgaa gaacgggccc agaccaagct ggaggaggcc       300
     atttctgcct tgcagcagat ggccccaggc ctgggccgcg atatcgccca gcggcaggta       360
     gaggccgcgc tatcgcgcat tcgggctacc gggatggagc agaaagcagg aggtgcaaag       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page