(data stored in ACNUC7421 zone)

EMBL: CP001743.PE8

CP001743.PE8         Location/Qualifiers
FT   CDS_pept        8087..8410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0008"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; SPTR:
FT                   A7D5P4 Branched-chain amino acid transport; KEGG:
FT                   pmy:Pmen_3294 branched-chain amino acid transport; COGs:
FT                   COG4392 membrane protein; InterPro IPR008407; PFAM:
FT                   Branched-chain amino acid transport protein (AzlD)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26790"
FT                   /protein_id="ADD26790.1"
FT                   /translation="MTSLDIWLNILGLALIAFAVRYYPMALLERFRLPPLVRQGLRYVP
FT                   AATLAGLVFPALLTHNGRWAGLAHPELWAGLVAALVAWRFKNALLTIGVGLLALWLLRS
FT                   VGL"
     atgacctcgc tcgatatctg gctcaacatc ctggggctcg ccctgatcgc cttcgcggtg        60
     cgctactacc ccatggccct cctcgagcgc ttcaggctgc ccccgctggt gcggcaaggc       120
     ctgcgctacg tgcctgctgc gaccctggcg gggctggttt tcccggcctt gcttacgcac       180
     aacggccggt gggccgggct ggcacacccc gagttgtggg ccgggctggt cgctgccttg       240
     gtggcctggc gcttcaagaa cgcgctgctc accattgggg tggggctgct ggccctgtgg       300
     ctgctgcgct cggtggggtt atga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page