(data stored in ACNUC7421 zone)

EMBL: CP001743.PE80

CP001743.PE80        Location/Qualifiers
FT   CDS_pept        complement(67303..67581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26862"
FT                   /protein_id="ADD26862.1"
FT                   /translation="MDAKTLVLLAVGGVLVYFGWKALGQPQAQTDPAEPDNQQQEQPGS
FT                   GWNDGWNPDYQNPGGGAPGFGYGSFSNPCAIFPSLCRPSTPLGGYEI"
     atggacgcta aaacccttgt tttgcttgcg gtgggaggtg tgctggtgta cttcggctgg        60
     aaggccctgg gccagcccca ggcgcagacc gacccggccg aaccagacaa ccagcagcaa       120
     gagcagcccg gctccggctg gaacgacgga tggaaccccg actatcagaa ccccggcggg       180
     ggtgcaccgg gctttggcta cggctcgttc agcaacccct gcgcgatctt cccaagcctc       240
     tgccgccctt cgacgccgct tggagggtat gagatatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page