(data stored in ACNUC7421 zone)

EMBL: CP001743.PE81

CP001743.PE81        Location/Qualifiers
FT   CDS_pept        complement(67571..67762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26863"
FT                   /protein_id="ADD26863.1"
FT                   /translation="MEFLDAVDKGLGVVAFLAFLKLVFSDLQEIKAAMRQIEKHLAIQV
FT                   ELSAQARARKKEEVRNGR"
     atggaattcc tggacgccgt ggacaagggc ctgggggtgg tggcctttct ggcttttctg        60
     aagctggtct tcagcgatct gcaggagata aaagcggcca tgaggcagat agaaaaacac       120
     ctggcgatcc aggttgaact atcggcccag gccagggcca ggaaaaaaga agaggtgcga       180
     aatggacgct aa                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page