(data stored in ACNUC7421 zone)

EMBL: CP001743.PE82

CP001743.PE82        Location/Qualifiers
FT   CDS_pept        complement(67762..68403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10367 gene product from transcript
FT                   GH10367-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26864"
FT                   /protein_id="ADD26864.1"
FT                   /translation="MKPIEVFAVVGAGGLAAFGLYTYARSRPKAEETVPGIPPQVPTHP
FT                   GVSGQERTSLCQVLTGYRSKLKEYEDLRADAEKKMRDLESLAQGNCRSYAQDPTFQYHC
FT                   NGFPICGINEWWTVSGTQTNQDAYNACMTFLQAGGGLEQRKHPKKEGSSWDDTWADIDR
FT                   INSQIGAAYNQVQNLRNQYQEAQRQAEEARQQINNLRRRIADLEAQGVFC"
     gtgaagccga ttgaggtatt cgctgttgtg ggcgccggag gcctggccgc ctttgggctg        60
     tacacctacg ccaggagccg gcccaaagcg gaagagacgg tgcccggcat cccgccccag       120
     gtgcccaccc accccggtgt ttcagggcag gagcgcacca gtttgtgcca ggtgctcacc       180
     ggataccgct ccaaattgaa agagtacgaa gacctgcggg ccgatgccga aaaaaagatg       240
     cgcgacctgg aaagcctggc ccagggcaac tgccgcagtt acgcccagga tcccaccttc       300
     cagtaccact gcaacggctt tccaatatgc ggtatcaacg aatggtggac agtaagcggc       360
     acccagacca accaggacgc ctacaacgcc tgcatgacct tcctgcaggc cgggggtggc       420
     ctcgagcagc gcaaacaccc caaaaaagaa ggcagctcct gggacgatac ctgggcggac       480
     attgaccgca tcaacagcca gatcggggcc gcctataacc aggtgcagaa tctgcgcaac       540
     cagtaccagg aggcccagcg ccaggcggaa gaagcgcggc agcagatcaa caacctgcgc       600
     cgccggattg ctgatctgga agcccagggg gtgttttgct ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page