(data stored in ACNUC7421 zone)

EMBL: CP001743.PE83

CP001743.PE83        Location/Qualifiers
FT   CDS_pept        complement(68390..68731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26865"
FT                   /protein_id="ADD26865.1"
FT                   /translation="MELLGFLGSALGGLFGFLGEDRKARAIEEAARAQVQTSRNLVDGA
FT                   IAQWAELRRAEEAKAAAQRDLGYWQEDTQRTRIYYNYQAARSGQAALLLVTGAGLLGVI
FT                   LWRLGREAD"
     atggagttgc ttgggtttct cggaagtgcg ctggggggtc tctttgggtt tcttggcgaa        60
     gatcgcaaag ccagggctat tgaagaggcc gctcgagccc aggttcagac ctcgcggaac       120
     ctggtggacg gggccattgc ccagtgggcc gagctgcgcc gggcggagga agccaaagcc       180
     gcagcccagc gtgacctggg ctactggcag gaggacaccc agcgcacccg catctactac       240
     aactaccagg ccgctcgttc aggccaggcc gcgctgttat tggttaccgg cgcgggcctg       300
     ctcggcgtga ttctgtggag gttggggcgt gaagccgatt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page