(data stored in ACNUC7421 zone)

EMBL: CP001743.PE85

CP001743.PE85        Location/Qualifiers
FT   CDS_pept        complement(69086..69961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0086"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26867"
FT                   /protein_id="ADD26867.1"
FT                   /translation="MAILDNLGNLLRRGLDTFRDLPRLETSNSQQAAAPVRPAPAAVQM
FT                   SDWAFAWIDGEDIESTGFPYRANEWFPLAQMRTPETAHFRVMAGEKRLRVYLKGQQTVA
FT                   GQNLGAPQARTVNLPYLIQSAQGAPTLPSAYHPDVAVWAQVGGVWQKLVITSVNYAGGQ
FT                   VTFTEPAGVPTTSNIEIYYTHADGQFRFRVARDAGGIDDSVATVFNQSFGTMHSVDQNN
FT                   LETMLAWPQQVELVPGTRLVLEVRTTQVPMVWNDRAGHYVHIAALARRVQVLDKGQINR
FT                   LAELENRAGL"
     atggctatcc tggataacct tggcaacctg cttcggcgtg gcctggacac ctttcgtgat        60
     ttgccccgcc tggaaacctc gaactcccag caggcggctg caccagttcg cccggcaccc       120
     gcagcggtgc agatgagcga ctgggccttc gcctggattg acggggagga catcgaaagt       180
     actggcttcc cctaccgggc caacgagtgg tttccgctgg cccagatgcg cacccccgag       240
     accgcccact tccgcgttat ggcgggggag aaacgcttgc gcgtctacct gaaggggcag       300
     cagaccgtgg ccgggcagaa cctgggcgca ccccaggccc gcaccgtcaa cctgccctac       360
     ctgatccaga gcgcccaggg ggcccccacc ctgccctctg cctaccaccc cgacgtggcg       420
     gtatgggccc aggtgggtgg ggtgtggcaa aaactcgtta ttaccagcgt gaactacgcc       480
     ggcggccagg taacattcac cgagccggcg ggggtgccca ccaccagcaa catcgagatt       540
     tactacaccc atgccgacgg ccagttccgc ttccgggtgg cccgggacgc gggcgggatt       600
     gacgatagtg tagcgacggt gttcaaccag tccttcggca ccatgcactc ggttgaccag       660
     aacaacctgg aaaccatgct ggcctggccg cagcaggtgg agctggtgcc gggcacccgg       720
     ctggtgctcg aggtacgcac cacccaggtg cccatggtct ggaacgaccg ggcgggccac       780
     tacgtccaca tcgcggccct ggcccgccgg gtgcaggtgc tggataaggg ccagatcaac       840
     cgcctggccg agctggagaa ccgggcgggg ctgtaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page