(data stored in ACNUC7421 zone)

EMBL: CP001743.PE87

CP001743.PE87        Location/Qualifiers
FT   CDS_pept        complement(70499..70915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0088"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S9 Major structure protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26869"
FT                   /protein_id="ADD26869.1"
FT                   /translation="MAEQAAIQAGRDMQKLASTSNPLEVVQNPIVVATSLGVLGAYMAR
FT                   KTIYTSRRDLFGWAAKGPDGKVRYYKVGSDGKPTTTEVPNAYTNRLLLNLGGVLLGTLL
FT                   INNKLTDDPMVDYIGLGVAAGSFANLVMTLLAID"
     atggcggaac aggcggcgat tcaagcgggc cgggacatgc aaaagctagc cagcacctcc        60
     aaccccctgg aggtggtgca gaacccaatt gtggtcgcca cctccctggg cgtgttgggg       120
     gcctatatgg cccgcaaaac catctacacc agtcggcgtg acctgtttgg ctgggccgct       180
     aagggcccgg acggcaaggt gcgctactac aaggtgggca gcgacggaaa gcccaccacc       240
     acggaagtgc ccaacgccta caccaatcgg ctgctgctga acctgggcgg cgttctactc       300
     ggaaccctgc tcatcaacaa caagctgacc gatgacccca tggtggacta catcggtctg       360
     ggagtcgcgg cagggtcgtt tgcaaatttg gtcatgaccc tgctggccat tgactag          417
//

If you have problems or comments...

PBIL Back to PBIL home page