(data stored in ACNUC7421 zone)

EMBL: CP001743.PE89

CP001743.PE89        Location/Qualifiers
FT   CDS_pept        complement(72362..72556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0090"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: B3XVS9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26871"
FT                   /protein_id="ADD26871.1"
FT                   /translation="MNFDAIKNNAFPIAVLAGSLYLGLGRLKNLREGQGCPKCETAQAV
FT                   VAFALAAWAGWELWQQYQV"
     gtgaattttg atgccatcaa aaacaacgcc ttccccatcg ccgtgctggc cggtagcctc        60
     tacctgggcc tgggccgcct aaagaacctg cgcgaagggc agggctgccc caagtgcgag       120
     accgcccagg ccgtggtcgc cttcgccctg gccgcctggg cagggtggga actgtggcag       180
     caataccagg tgtga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page