(data stored in ACNUC7421 zone)

EMBL: CP001743.PE91

CP001743.PE91        Location/Qualifiers
FT   CDS_pept        complement(73070..73402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0092"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26873"
FT                   /protein_id="ADD26873.1"
FT                   /translation="MLILGLRLQTQEEVEAFTRAFQGGVLPMLPPAPVLDALKVGEALA
FT                   AYGIGKNRLPLQGGVEHLPPWLRILLGAGVMAMSVYGGMRAVQEIRARSAPNPPAGGSA
FT                   DEPAQA"
     atgctaatcc tggggctgag gctgcaaacc caggaagaag tggaagcctt cacccgggct        60
     tttcaggggg gcgtactccc catgctccct cccgcaccag tgctggacgc gctcaaggtg       120
     ggggaggccc tggccgccta cggcatcggc aagaaccgcc tgccgctgca agggggcgtg       180
     gagcatctgc ccccctggct gcgcatcctg ctgggggcgg gggtgatggc catgagcgtc       240
     tacggaggta tgcgtgcagt tcaggaaata cgggctcgga gtgctcctaa tcctcctgct       300
     gggggtagtg ctgatgaacc agcccaggcc tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page