(data stored in ACNUC7421 zone)

EMBL: CP001743.PE92

CP001743.PE92        Location/Qualifiers
FT   CDS_pept        complement(73521..73934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbk:BARBAKC583_0145 TolA domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26874"
FT                   /protein_id="ADD26874.1"
FT                   /translation="MTLRLPEPLLAEPVEMPALQPEAPRQVEAVPLGPDELDPVVTQAV
FT                   ESQPEVSMPKTAAVENENPSEKVSKEKAEPANPKPTPKSVQGYAVAVLGAVLVVAAAVL
FT                   GMKGGTGATTPCGNCGGNRTGGSAVSGSGPIIY"
     atgaccctaa ggctgccaga accactgttg gcagaaccgg tggagatgcc agctttgcaa        60
     cccgaagcgc cccgccaggt ggaggccgtt cccctggggc cagacgaact cgatcccgtt       120
     gtgacccagg cagtggaatc acagcccgag gtatccatgc caaaaacagc ggcggttgaa       180
     aacgaaaacc cttcggaaaa ggtttccaaa gaaaaagccg agcctgccaa ccccaaacct       240
     actcccaaat ctgttcaggg gtacgccgtg gccgttctgg gtgcggtgct ggtagtggct       300
     gcggcagtcc tgggtatgaa aggaggcacc ggtgcaacaa ccccctgtgg gaactgcggc       360
     ggaaacagaa ccggcggttc tgcggtttcc ggatccggcc ccatcatcta ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page