(data stored in ACNUC7421 zone)

EMBL: CP001743.PE93

CP001743.PE93        Location/Qualifiers
FT   CDS_pept        complement(73938..74450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0094"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26875"
FT                   /protein_id="ADD26875.1"
FT                   /translation="MAFQRVPVNSDKPLGPGTYEIVLAHQSGDISRVTRSDLERALQAK
FT                   YGSSIKVLDWGKKGSDLVIRLQVTATPTASTSGAQDPWAITPALSWYTPDDLIQPAFLP
FT                   ALPAIFTAAAVIAILYLTWRIVATIKETVQLVPEPARSVAVTGSGVGLAALGIGVLALA
FT                   VWPRGRR"
     atggcttttc aacgcgtgcc tgtaaattca gacaagccac ttgggccggg cacctatgag        60
     atcgtattag cccaccaaag tggcgatatt tcgcgggtaa cccgatccga cctagaacga       120
     gcgctgcaag caaaatacgg ctcgagtata aaagtgttgg actggggtaa aaaaggcagc       180
     gacctggtga tccggctcca ggtaaccgcc acccccaccg cctccacctc gggggcccag       240
     gatccgtggg ccataacccc ggccttaagc tggtataccc cggatgacct gatccagccc       300
     gccttccttc ccgcgctgcc agccattttc accgcagcag cggtcatagc gattctgtat       360
     ctaacctggc gcatcgtagc caccatcaaa gagaccgtgc agctcgtgcc cgagccggcc       420
     cgctcggtag cggtcactgg ctccggcgtg ggcctagccg ccctgggcat aggcgttctg       480
     gccctggcgg tttggcccag aggcaggagg taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page