(data stored in ACNUC7421 zone)

EMBL: CP001743.PE94

CP001743.PE94        Location/Qualifiers
FT   CDS_pept        complement(74556..74849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0095"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26876"
FT                   /protein_id="ADD26876.1"
FT                   /translation="MEDIRKGRPSRRLLDLASRKREPVPLESQPLEMLLYALFGNLQAA
FT                   RSIGQALGGDIRNIHGWDIRDLESLPGVGRGVIGKLAALVEIVRRLHQKKAT"
     atggaagaca tacgcaaagg acgcccttca cgccgcctgc tcgacctggc ctctcgcaag        60
     cgcgagcccg ttccgctaga aagccaaccc ctagaaatgc tgctctacgc ccttttcggg       120
     aatctccagg ccgcccgttc catcggccag gctcttgggg gcgacatccg caacatccac       180
     ggctgggaca tccgcgacct ggaatcccta cccggcgtgg gtaggggggt tattggcaag       240
     ctggcagcgc tggtggaaat agtacgtcgg ctacaccaaa agaaagcgac ctaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page