(data stored in SCRATCH zone)

EMBL: CP001778.PE100

CP001778.PE100       Location/Qualifiers
FT   CDS_pept        110775..111353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0102"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce6308
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39823"
FT                   /db_xref="GOA:D3Q0F9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39823.1"
FT                   /translation="MEPGLRERKKQRTRDALVAAAVDLFQRQGYEHTTVAQIAEAAELS
FT                   TRTFFLHFPTKEDVLLANTDRRIAAGVQAITTHRANTPLATVLLTAMERMIDDADPSDL
FT                   TQLRAQLLVRTPALQARLFQRLFSGQTALIDALTTTFDVDRVEAAARVGAMIGAVNAAT
FT                   LASLDQGDPPSRQREAMTRAARLAVTPPA"
     atggaaccgg gccttcggga acgcaagaaa caacgcactc gcgacgcact agtggccgcc        60
     gccgtcgacc tcttccaacg ccagggctac gaacacacga cggtggccca gatcgccgag       120
     gccgccgagc tgtccacccg caccttcttc ctccacttcc ccaccaaaga ggacgttctg       180
     ctggccaaca ccgaccgccg catcgccgcc ggggtccagg cgatcaccac ccaccgggcg       240
     aacaccccgc tggccaccgt cctgctgacg gcgatggagc gcatgatcga cgacgccgac       300
     cccagcgacc tcacccaact gcgggcccag ctcctcgtcc gaacccccgc cctccaggcc       360
     cgcctcttcc aacgcctctt ctccggccaa accgccctca tcgacgccct caccaccacc       420
     ttcgacgtcg atcgcgtcga agcggcggcc cgcgtcggcg ccatgatcgg cgcggtcaac       480
     gccgccaccc tcgccagcct cgaccagggc gaccccccgt cccgccaacg cgaagcgatg       540
     acccgagccg cccgcctcgc cgtcacccca ccggcgtga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page