(data stored in SCRATCH zone)

EMBL: CP001778.PE103

CP001778.PE103       Location/Qualifiers
FT   CDS_pept        113007..114920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39826"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39826.1"
FT                   /translation="MEVDEILECLVALETGARQQKPDESRYVLIETEWDGESSGTWSAS
FT                   DDPVSRSLVLDALASKVYEYGDLLAELDDDEHPLLASVSSPERKALAQVLLGLQEAFQP
FT                   LSDVPVGNPFLDDATTSQGAARPVVVVRDAESQGLDFTWAVMELAPRAEPEGDDRALLA
FT                   ATARGDDDAIAAALRSGADANALDAEGMTPLHHAVAHRRLEAVAMLLKAGADPNAQADF
FT                   RNAPCFASLDGQGRVHPGAARIDDDEHWWIIGELLEGGADVNALDPRGSTLVDLAIATV
FT                   PYPDQVVAYLRDRGGRHASLARREFTEHLSRLSPGDWDRQAVSVNEVRYLLENEGPVVV
FT                   TDALHLLLKREWTEDEVSAETLFELTDLLLSHGARDNVATGQNPLDRAYELFGNGKRPQ
FT                   YQVVTYRLRKAGFARSIRSMLEWLPEGDVAAQRAHLAELRERLEASGPQPEALYWLLSP
FT                   RGWSEHEIGGEFFGELIDVLLSHGGQNVVVNGRTPLGWSRIWLGRGGHPQYRIVVDRLL
FT                   AAGFTYSARDYLDRIPLGDVEEQREFLPELRERLEAEGPQPEAMHWLLSPNSKWSPDEV
FT                   SGEIMGELTELLLEYGGRDTDVNGTRPLDRAINRVKHDGLANYQPVVNRLRAAGFRRGG
FT                   QT"
     gtggaggttg acgaaatact tgaatgcctc gtcgccttgg aaaccggcgc acggcaacag        60
     aaaccggacg aatcccgata cgtcctgatc gagaccgagt gggacggcga gtcctccggc       120
     acctggtcgg catccgacga tccggtgtcg cggtcgcttg tactggacgc gctcgcgtcc       180
     aaagtgtacg aatatgggga cctgctggcg gagctcgacg acgacgagca cccgctgctg       240
     gccagcgtct cctcaccgga acgaaaggcc ctggcccagg tgttgctggg cctgcaggag       300
     gcgttccagc cgttgagtga tgtgcccgtc ggcaacccgt tcctcgacga cgccaccacc       360
     tcacagggtg ccgcgcgccc cgtggtggtc gtgcgcgacg cggagtcgca gggactcgac       420
     ttcacctggg ccgtcatgga actggctccc cgggccgagc ccgagggtga cgatcgtgcc       480
     ctgctggccg ccaccgcgcg cggggatgac gacgccatcg cggcggcgct gcgctcgggt       540
     gccgacgcga acgcgctcga cgccgagggc atgacgccgc tgcaccacgc ggtcgcgcat       600
     cgcaggcttg aagcggtggc gatgctgctc aaggcgggtg ccgatcccaa cgcgcaggcc       660
     gatttccgca acgctccctg cttcgcgagt ctcgacgggc aggggcgggt gcaccccggg       720
     gcggctcgta tcgatgacga cgagcactgg tggatcatcg gcgagctgtt ggagggcggt       780
     gcggacgtca acgccctcga cccgcgcggc agcaccctgg tcgacctggc gatcgcgacc       840
     gtgccgtacc cggaccaggt cgtcgcctac ctgcgggacc ggggtgggcg gcacgcgagt       900
     ctcgcgcgcc gcgagttcac cgagcacctg agtagactgt cccctgggga ttgggatcgg       960
     caggcggtga gcgtcaacga ggtgcggtac ctgttggaga atgagggccc cgtggtcgtc      1020
     accgacgcgc tgcacctgtt gctgaagcgg gagtggaccg aggacgaggt ctcggccgag      1080
     accctgttcg agctgacgga tctgctgctg agtcacggcg cgcgcgacaa cgtcgccacg      1140
     ggtcaaaatc cgctcgatcg ggcatacgaa ctgttcggta acgggaagcg tccacagtat      1200
     caagtggtga cgtaccggtt gcggaaggcc ggtttcgccc ggtcgatccg gtccatgttg      1260
     gaatggcttc ccgagggcga tgtcgcggca cagcgcgcgc atctggccga gctgcgggag      1320
     cggctggaag cctcgggacc gcagccggag gcgttgtact ggctgctgtc cccgcgcggg      1380
     tggtccgagc acgagatcgg cggcgagttc ttcggcgaac tgatcgacgt gctgctgagc      1440
     cacggtggcc agaacgtcgt ggtgaatgga cgcactccgc ttggctggtc ccggatctgg      1500
     ctcggccggg gcgggcaccc gcagtaccgg atcgtggtgg accggttgct ggcggcgggg      1560
     ttcacgtact ccgcgcgcga ctacctcgac cggatcccgc tcggtgacgt cgaggagcag      1620
     cgggagttcc tccccgagct gcgggagcgg ctggaagccg aagggccgca acccgaggcg      1680
     atgcactggc tgctgtcgcc caacagcaag tggtcgcccg acgaggtctc gggcgagatc      1740
     atgggcgagc tgacggagct gttgctggag tacgggggcc gggacaccga cgtgaacggc      1800
     acccggccgt tggatcgggc gatcaaccgg gtcaagcacg acgggctcgc gaactaccag      1860
     ccggtcgtga accggttgcg ggccgcggga ttccgccgag gcggccaaac gtag            1914
//

If you have problems or comments...

PBIL Back to PBIL home page