(data stored in SCRATCH zone)

EMBL: CP001778.PE112

CP001778.PE112       Location/Qualifiers
FT   CDS_pept        complement(122022..122669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0114"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: vei:Veis_1888
FT                   beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39835"
FT                   /db_xref="GOA:D3Q1I7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1I7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADD39835.1"
FT                   /translation="MTEDDGIVRTLPNALAAHARHFYNSGGTPVEPRRAATVLILRDLP
FT                   YTAGAPGGVEVYMLRRAASMVFAGGMYAFPGGRVDPSDIDVLSAAVREVREETGLRLTE
FT                   LHAWSRWVTPEFEPRRYDTWFYVARLPEGAQPLDISGEADWAGWLPPKRALADHNDQML
FT                   PPTAVTLTELSGFNSVDSVLTVAEDRDLTPITPRAVIDNGTVRLALPGDPEF"
     ttgactgagg acgatgggat cgttcggacg cttcccaacg cgctggccgc ccacgccagg        60
     cacttctaca acagcggcgg caccccggtg gaaccgcgcc gggcggcgac cgtgttgatc       120
     ctgcgcgacc tgccctacac cgccggggcg cccggcggcg tcgaggtcta catgttgcgg       180
     cgcgcggcca gcatggtgtt cgcgggcggc atgtacgcgt tcccgggcgg gcgcgtggat       240
     ccgtccgaca tagacgtact gtcggcggcg gtgcgcgagg tgcgcgagga gaccgggctg       300
     cggctgaccg aactgcacgc ctggagccgt tgggtgacac cggagttcga gccgcgccgc       360
     tacgacacct ggttctacgt ggcccggctg cccgagggcg cccagccgct ggacatcagc       420
     ggcgaggccg actgggcggg ctggctgccg cccaaacggg cgctggccga ccacaatgac       480
     cagatgctgc cgccgacggc ggtgacgctg acggagctgt ccggcttcaa ctcggtcgac       540
     agcgtcctga ccgtcgccga ggaccgcgac ctgacgccga tcacgccccg cgcggtgatc       600
     gacaacggca ccgtgcggct ggcgctgccc ggcgacccgg agttctag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page