(data stored in SCRATCH zone)

EMBL: CP001778.PE117

CP001778.PE117       Location/Qualifiers
FT   CDS_pept        complement(127165..128682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0119"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: gur:Gura_1785 apolipoprotein N-
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39840"
FT                   /db_xref="GOA:D3Q1J2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J2"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADD39840.1"
FT                   /translation="MDAVRKTPLWIVVVATAASAVLLYSGTGIYAVAALTWLAPVPVLW
FT                   LAPRVSARAAFLTSAVAGLVGATNNLIWYITSPSDAPLWPMGLMIMLAYSLTFALGVLP
FT                   YRALLLRGRALLAAVTLPAVWTVVLWIVAVSNPTGIMGTLASAQGDVPLVLQTTTVTGM
FT                   WGLEFLVLFVPAGIAALFAPSVGAGARWRTAGVAVVVAGLVLGLGAWRLVGGGEGPSQT
FT                   VALLSNNDSGWGARLDQPAGEELVAKYEKRIAALPDGVEAVVLPEGEFTADEESLGVLV
FT                   EPMRRLAKEKDLTIVVGAVYKDEPKQYNNALVIPPKGDVVTYTKHHDGGPNTLGTELAF
FT                   QPGHGKRVGIAICADLNIPNPARQYGVAGARALLVPAADERYDGWLHARAGVLQTVANG
FT                   SSMAWAGRTGTLTVTDGYGRVLAEKDSGGAGEFTEVVTEVPQGPGATVYSRYGDWFVWL
FT                   CIGLAAVGTVLALSKRRDKPSPAASATVEAAAAASGRPTEPVRSGDS"
     atggatgccg ttcgtaagac cccactgtgg attgttgttg tcgccacggc cgcctcggcg        60
     gtgctgctct actccggcac cggtatctat gccgtcgccg ctttgacgtg gctggcgccg       120
     gtgccggtgc tgtggctggc accccgggta tcggcgaggg ccgcgttcct cacctcggcg       180
     gtggcgggcc tggtgggagc gacgaacaac ctgatctggt acatcacgtc gcccagcgac       240
     gcgccactgt ggccgatggg cttgatgatc atgctggcgt actcgctgac cttcgcgctg       300
     ggtgtgctgc cgtaccgggc gttgctgctg cgggggcggg cattgttggc ggcggtgacg       360
     cttccggccg tgtggaccgt cgtcctgtgg atcgtggcgg tctccaaccc gaccgggatc       420
     atgggaaccc tggccagcgc gcagggtgat gtgccgttgg tgctgcaaac cacgacggtg       480
     accgggatgt ggggactgga gttcctggtt ctgttcgtac cggcgggaat cgcggcgttg       540
     ttcgcgccga gtgttggcgc gggggcgcgc tggcgtacag cgggtgtcgc cgtcgtcgtc       600
     gcgggactgg tgctggggct gggggcctgg cggctggtgg gcggcggtga ggggccgagt       660
     cagaccgtgg cgttgctgtc caacaacgac agtggttggg gggcgcggct cgatcagcct       720
     gcgggtgagg agctggtggc gaagtacgag aagcggatcg cggcgctgcc ggacggggtg       780
     gaggctgtcg tgttgccgga gggcgagttc accgctgacg aggagagcct tggtgtgctt       840
     gtcgagccga tgcggaggct ggcgaaggag aaggatctga ccattgtggt gggggcggtg       900
     tacaaggatg agccgaagca gtacaacaac gcgctggtca tcccgccgaa gggtgacgtc       960
     gtcacgtata ccaagcatca tgatggtggg ccgaacacgc tggggacgga gctggctttt      1020
     cagccggggc acgggaagcg ggtggggatc gcgatctgcg cggacctgaa cattcccaat      1080
     ccggctcggc agtacggggt ggcgggggct cgggcgctgc tggttccggc ggcggacgag      1140
     cgttatgacg gttggttgca cgcgcgggcc ggggtgcttc agacggtcgc caatgggtcg      1200
     tcgatggctt gggcgggccg caccggaact ctcaccgtca ccgacgggta tgggcgggtg      1260
     ttggcggaga aggactccgg tggggcgggt gagttcaccg aggtggtcac cgaggtgcca      1320
     caaggtcccg gggccaccgt gtacagccgg tatggcgact ggttcgtgtg gctgtgcatc      1380
     gggctggccg ccgtcgggac ggtgctggcg ttgagcaagc ggcgcgacaa gccgtcgcca      1440
     gccgcctccg cgacggtcga ggctgccgct gccgcgagcg gtcgtcctac tgaacctgtt      1500
     cgaagtggag actcctga                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page