(data stored in SCRATCH zone)

EMBL: CP001778.PE13

CP001778.PE13        Location/Qualifiers
FT   CDS_pept        complement(17859..18845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0013"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mlo:mll2594 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39736"
FT                   /db_xref="GOA:D3PTX8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTX8"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADD39736.1"
FT                   /translation="MRAIRQYEFGPAENLLYEELPDPVPGPGQLRIAVEAAGVHLLDAA
FT                   IRSGDAGSHPFGNPELPMTPGREVAGTVDALGPDVDESWLGRRVVAHLGIASGGYAELA
FT                   VREAEAVHPIPDGLSSEAAVAMIGTGRTAVGVLDVAAPTADDVAVVLAAAGGIGSLLVQ
FT                   ALRASGATVVGAAGGEAKTRLVRGLAGGVIAVDYTEPGWPKRVTEALAGRQPTVVFDGV
FT                   GGDNGRAALELLGVGGRFVMFGWSAGEITELSGQDIVDRGLSVTSALGPRMLSRPGGLR
FT                   GLEIEALAKVADGTMSPPVRTFPLKDASGAHEALVNRDTVGKVVLVP"
     atgcgcgcca tccgccagta cgagttcggt ccggccgaga acctgctcta cgaggaactt        60
     cccgatcccg ttcccggccc cggtcagctc cgtatcgcgg tggaggccgc cggtgtgcac       120
     ctgctggacg ccgcgatccg ttccggcgac gccggttcgc accccttcgg caacccggaa       180
     ctgccgatga cgccgggccg cgaggtcgcc ggaacggtgg acgcgctcgg gccggacgtc       240
     gacgagtcct ggttggggcg gcgggtggtc gcgcatttgg gcatcgccag cggcggttac       300
     gccgagctgg cggtgcgcga ggccgaggcc gtccatccca tcccggacgg tctgagcagc       360
     gaggcggcgg tggcgatgat cggcaccgga cgcaccgccg tgggcgtgct cgacgtggcc       420
     gcgcccaccg ccgacgacgt cgcggtggtg ctggccgccg cgggcgggat cggcagcctg       480
     ctggtgcagg cactgcgggc ttccggcgcg accgtcgtgg gcgccgccgg tggcgaggcc       540
     aagacccggt tggtgcgcgg gctcgcgggc ggcgtcatcg ccgtcgacta caccgagccc       600
     ggctggccga agcgggtcac cgaggcgctt gcgggacggc agccgaccgt cgtgttcgac       660
     ggtgtcggcg gcgacaacgg ccgcgccgcc ctggaactgc tgggcgtcgg cggccggttc       720
     gtcatgttcg gctggtcggc gggggagatc accgaactgt ccggacagga catcgtggac       780
     cggggcctga gcgtcacctc ggcactgggc ccgcggatgc tgtcgcggcc cggcggcctg       840
     cgcggtctgg agatcgaggc gctggccaag gtcgccgacg gcacgatgtc accgccggtg       900
     cgcaccttcc cgctcaagga cgcctccggc gcgcacgagg cgctggtgaa ccgcgacacg       960
     gtcggcaagg tcgtgctggt tccctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page