(data stored in SCRATCH zone)

EMBL: CP001778.PE135

CP001778.PE135       Location/Qualifiers
FT   CDS_pept        141382..142806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0137"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: gbm:Gbem_2801 replicative DNA helicase;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39858"
FT                   /db_xref="GOA:D3Q1L0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L0"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ADD39858.1"
FT                   /translation="MDHDTYANRKGGAQQSRAGDYPDEPPPEEGGHEFERTPPQDVMAE
FT                   RSVLGGMLLSKDAIADVVEILKTNDFYKPAHATIFDVICDKYARGEPADAVTMVAALND
FT                   LGELGKVGGAPYLHTLISSVPTAANAAYYARIVSERAILRRLIEAGTRIVQLGYGTAAG
FT                   GGRDVDDLVDLAQQAVYDVTERRVSEDFAVLSELLQPTLDEIEAVGESAGAMTGVPTGF
FT                   ADLDRLLNGLQPGQLIIVAGRPGAGKSTAAMDFIRHAALHHQQAAAMFSLEMSKVEIVM
FT                   RVLSAETRVPLHVLRSGQLSDDDWTRLARRMGEISEAPMFVDDTPSMTLMEIRAKARRL
FT                   KQRHNLKLIVVDYLQLMSSPKRVESRQQEVSEISRGMKLLAKEVECPVIAVAQLNRGPE
FT                   QRTDKRPQLSDLRESGSLEQDADVVILLHRDDYYDKESPRAGEADMIVAKHRNGATDTI
FT                   TVAAQLHLSRFVDMAV"
     atggatcacg acacgtacgc gaaccgtaag ggtggggccc aacagtcccg cgccggcgac        60
     taccccgacg agccgccgcc cgaggagggc ggtcacgagt tcgaacgcac cccgccccag       120
     gacgtcatgg ccgagcgaag cgtcctgggc ggcatgctgc tcagcaagga cgccatcgcc       180
     gacgtcgtcg agatcctcaa gaccaacgac ttctacaagc ccgcgcacgc caccatcttc       240
     gacgtcatct gcgacaagta cgcgcgcggc gaacccgccg acgccgtcac catggtcgcg       300
     gccctcaacg acctcggcga actgggcaag gtcggcgggg cgccgtacct gcacaccctg       360
     atctcctcgg tccccaccgc cgccaacgcc gcctactacg cccgcatcgt cagcgaacgc       420
     gccatcctgc gccgcctcat cgaggccggg acccggatcg tgcaactggg ctacggcacc       480
     gccgcgggcg gcggccgcga cgtcgacgac ctggtcgacc tggctcagca ggccgtctac       540
     gacgtcaccg aacgccgggt cagcgaggac ttcgcggtcc tgtccgaact gttgcagccc       600
     actttggacg agatcgaggc ggtcggcgag tcggccggcg ccatgaccgg cgtgcccacc       660
     ggtttcgccg acctcgaccg gctgctcaac ggcctgcaac ccggacagct catcatcgtg       720
     gccggtcgac ccggtgccgg taagtccacc gccgcgatgg acttcatccg gcacgccgcc       780
     ctgcaccacc agcaggccgc ggcgatgttc tcgctggaaa tgagcaaggt cgagatcgtg       840
     atgcgcgtgc tgtcggccga gacccgggtg ccgctgcacg tgctgcgttc cgggcagctg       900
     tccgacgacg actggacccg gctggcccgc cggatgggcg agatctccga ggccccgatg       960
     ttcgtcgacg acacgccctc gatgacgctg atggagatcc gggccaaggc ccgccgtctc      1020
     aaacagcgcc acaacctcaa actcatcgtc gtggactacc tgcagctgat gagttccccg      1080
     aaacgggtcg agagccgaca gcaggaggtc tccgagatct cccgaggcat gaagcttttg      1140
     gccaaggagg tcgagtgccc ggtgatcgcg gtcgcgcagc tcaaccgtgg cccggaacag      1200
     cgcaccgaca aacgtccaca gttgtcagac cttcgtgagt ccggttcgct ggagcaggac      1260
     gccgacgtgg tgatcctgct gcaccgtgac gactactacg acaaggagtc gccgcgcgcc      1320
     ggtgaggcgg acatgatcgt ggccaagcac cgtaacggcg ccaccgacac catcaccgtc      1380
     gccgcccagc tgcacctgtc ccggttcgtc gacatggccg tgtga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page