(data stored in SCRATCH zone)

EMBL: CP001778.PE149

CP001778.PE149       Location/Qualifiers
FT   CDS_pept        155218..155874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0152"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: mca:MCA2330 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39872"
FT                   /db_xref="GOA:D3Q1M4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD39872.1"
FT                   /translation="MRVLLVEDEEPLAGYIAVGLRKHGLAVDVAHDGQTALDKCDFTPY
FT                   DVVVLDRDLPVVHGDTVCQRLAAQGTARVLMLTASGTVEDRVDGLSLGADDYLGKPFAF
FT                   SELIARVRALARRSAPARPPLLRAADVVCDPARRTVERAGRPIHLTPKEFGVLEQLLAA
FT                   GGDVVSAETLLDKVWDEHADPFSNAPRITVGTLRRKLGEPPLIQTVTGAGYRVVP"
     atgcgggtgc tgctggttga ggacgaggag ccgctggccg gatacatcgc ggtcgggctt        60
     cgcaaacacg gactcgccgt cgacgtggcc catgatggac aaacggcgtt ggacaaatgc       120
     gacttcaccc cgtacgacgt ggtggtgctg gaccgggacc tgccggtggt gcacggggac       180
     acggtgtgcc agcggctcgc ggcccagggc acggccaggg tgctcatgct gaccgcctcg       240
     ggcaccgtcg aggaccgggt cgacgggctg tccctgggcg ccgacgacta tctgggcaaa       300
     ccgttcgcgt tctccgaact gatcgcccgg gtgcgggcgc tggcgcggcg tagtgccccg       360
     gcccggccgc cgttgctgcg cgccgccgac gtcgtgtgtg atccggcccg ccgtaccgtc       420
     gaacgcgccg gacgtccgat tcacctgacc cccaaggagt tcggggtctt ggagcagctg       480
     ttggcggcgg gcggcgacgt ggtcagcgcg gagaccctgc tcgacaaggt gtgggacgaa       540
     cacgccgacc cgttctccaa cgcgccccgc atcacggtcg gcaccttgcg ccgcaagctg       600
     ggcgagccgc cgctgatcca gaccgtcacc ggcgccggtt accgggtcgt gccgtga          657
//

If you have problems or comments...

PBIL Back to PBIL home page