(data stored in SCRATCH zone)

EMBL: CP001778.PE150

CP001778.PE150       Location/Qualifiers
FT   CDS_pept        155871..157067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0153"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   sfu:Sfum_2006 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39873"
FT                   /db_xref="GOA:D3Q1M5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADD39873.1"
FT                   /translation="MRWPRFTARGRLTLLYMAMVLGAGAVMTALTYVLMRSSLRRRSFV
FT                   HTDVDPDSPAGLPFPERFDELIERDRMTILSDLLVKATVALVVVSVLAAVLGWFVAGRV
FT                   LRPIRQISAASRRLSAENLAERVPVRGPADELAELADTVNGMLDRIQRGVAERDRALAS
FT                   QRLFTANAAHELRTPLTTMRTAIDVTLDGEPDRDELLAMIADLDTTVERSRRTLDGLLL
FT                   LAGSHAAPAEQSPVALDGLVAELLEAKAPAIAEHRIDVRRELFPAPALGDPLLLERLTG
FT                   NLIDNAVRYNHPDGHIALRTGTADGRAFLRVANSGPHVAPESAPGLLEPFVRGGGGRIR
FT                   ATGGVGLGLSIVRAVVTAHDGDLSIAANPDGGLTVTVELAVDPAAATRTDGGRDDHVA"
     gtgaggtggc cccgtttcac cgcgcgtggt cggttgacac tgctgtacat ggcgatggtg        60
     ctgggcgccg gtgccgtcat gacggcgctg acctacgtcc tgatgcgaag cagtctgcgg       120
     cgccgatcgt tcgttcacac cgatgtggac cctgattccc cggccggtct cccgttcccc       180
     gaacggttcg atgagctcat cgaacgtgac cggatgacca tactgtcgga tctgctggtc       240
     aaggcgacgg tggcgctggt cgtggtgtcg gtactggcgg cggtgctggg ctggttcgtg       300
     gcgggccggg tgctgcggcc gatccggcag atctcggcgg cgtcgcggcg gctgtcggcg       360
     gagaacctcg ctgagcgggt gccggtgcgg gggcccgccg acgaactcgc cgaactggcg       420
     gacaccgtca acggcatgct ggaccgcatc cagcgcggcg tcgccgaacg ggaccgggcg       480
     ctggcgagcc agcggctgtt caccgccaac gccgcccacg aactgcgcac cccgctgacg       540
     accatgcgca ccgccatcga cgtgaccctg gacggcgaac ccgaccgcga cgaactgctg       600
     gccatgatcg ccgacctcga caccaccgtc gaacgcagcc gccgcaccct cgacggcttg       660
     ctgctgctgg ccggtagcca cgccgctccg gccgagcaaa gcccggtcgc actggacgga       720
     ctcgtcgccg aactgctcga ggcgaaggcc ccggcgatcg ccgagcaccg catcgacgtg       780
     cgacgcgaac tgttccccgc accggcactg ggcgacccgc tgctgctgga acggttgacg       840
     ggcaacctga tcgacaacgc cgtccggtac aaccacccgg acggccacat cgcgctgcgc       900
     accgggaccg ctgacggcag ggcgttcctg cgggtcgcca actccggtcc ccacgtcgcg       960
     cccgagtcgg ccccggggct gctggaaccg ttcgtgcggg gcggtggcgg ccgcatccgt      1020
     gccaccggcg gcgtcgggct gggtctgtcc atcgtccggg ccgtcgtcac cgcccacgac      1080
     ggcgacctgt cgatcgcggc gaacccggac ggcggcctga ccgtcaccgt cgagctggcg      1140
     gtcgacccgg cggcggccac gcgcactgac ggcggccgag acgaccacgt ggcttag         1197
//

If you have problems or comments...

PBIL Back to PBIL home page