(data stored in SCRATCH zone)

EMBL: CP001778.PE167

CP001778.PE167       Location/Qualifiers
FT   CDS_pept        complement(172062..173144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0170"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ara:Arad_9759 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39890"
FT                   /db_xref="GOA:D3Q1P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD39890.1"
FT                   /translation="MADISIRNLSRTYSGQKAPATDDVSLDVADGEFMVFLGPSGCGKT
FT                   TLLRMIAGLELPDAGSVAIGGKDVTYLAPRNRNLSMVFQSYAVFPHRRVRANIGFGLKM
FT                   RGVAADEIARRVDRAADLLQLTDYLDRYPAQLSGGQRQRVAVARAIVVDADVLLMDEPL
FT                   SNLDALLRLSFRAELKKIVAELGTTTVYVTHDQAEALSLGDRVAVMRSGRIVQQGGPID
FT                   VYDSPADTFVGGFLGSPPMNFLDGEVADGPKLRVGEQSLAVPSALASFAGQPVKLGVRA
FT                   ENITVSQSRDESAVPATVDVVEPVGASVLLTVTVDGQELKVQAPPTFRIDPGATAWLTF
FT                   PADRLRFYDPESAMALETDR"
     atggctgaca tctcgatccg aaacctgtcc aggacctact caggacagaa ggccccggcc        60
     accgacgacg tgagtctcga cgtggccgac ggcgagttca tggtgttcct gggccccagc       120
     ggttgcggca agaccaccct gctgcgcatg atcgcgggcc tggagttgcc cgacgccggt       180
     tcggtggcca tcggcggcaa ggacgtcacc tacctggctc cccgcaaccg caacctgtcg       240
     atggtgttcc agtcctacgc ggtgttcccg caccgtcggg tccgggccaa catcggcttc       300
     ggcctgaaga tgcgtggtgt ggccgccgac gagatcgccc gccgggtgga ccgggccgcg       360
     gacctgttgc agctgaccga ttacctcgat cgctacccgg ctcagctttc gggcggtcag       420
     cggcaacgcg tcgcggtggc gcgggccatc gtcgtcgacg ccgacgtact gctcatggac       480
     gaaccgctgt ccaacctgga cgcgctgctg cggctgtcgt tccgggccga gctgaagaag       540
     atcgtcgcgg aactgggcac caccaccgtc tacgtcaccc acgaccaggc cgaggcgctg       600
     tcgctgggcg accgggtcgc ggtgatgcgc tccggccgga tcgtgcagca gggcggcccc       660
     atcgacgtgt acgactctcc cgccgacacc ttcgtgggcg gattcctggg ctcaccaccc       720
     atgaacttcc tggacggcga agtcgccgac ggcccgaaac tgcgcgtcgg cgagcagagc       780
     ctcgcggtgc ccagcgccct ggcgtccttc gccgggcagc cggtgaagct gggcgtgcgg       840
     gccgagaaca tcacggtctc gcagtcccgc gacgaatccg cggtgcccgc cacggtagac       900
     gtcgtcgaac cggtcggcgc ctcggtgctg ctgacggtca ccgtcgacgg ccaggaactc       960
     aaggtccagg caccgccgac gttccgcatc gaccccgggg ccacggcctg gctgaccttc      1020
     ccggccgacc ggctgcggtt ctacgatccc gaatccgcca tggcactgga gaccgatcga      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page