(data stored in SCRATCH zone)

EMBL: CP001778.PE169

CP001778.PE169       Location/Qualifiers
FT   CDS_pept        complement(174035..174916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0172"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120263 putative
FT                   permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39892"
FT                   /db_xref="GOA:D3Q1P4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD39892.1"
FT                   /translation="MAATQVTEVAPRRRRIPPVVWLIAPSVLFMAALMGWPTISGLIQA
FT                   FKTGDGFGFDNFARMAADPFFWPAVRNTLLLIVILIPVQFALALGMALLLRAKPKLSGL
FT                   YFYIWAIPLAVSDLAAGLVWLSIFTDHGYLNSFLSHLGIDGVNWLSYDSNTSMFFAVFI
FT                   AELWRATSLVLVIVVAGMQGIPKDYDEAAQVFGASYWQRLRHVTLPLLRPSLQVALILR
FT                   TILAFQTFAVAQALTGRDFPVLVGETYNWYVALRNPSVASALALVILAISMITAIVYLR
FT                   ALRDPSDKGGKR"
     atggccgcca cccaggtcac cgaagtcgcg ccgcgccgcc gccggattcc gccggtggtg        60
     tggctgatcg cgccgtcggt gctgttcatg gccgcgctca tgggctggcc gacgatctcg       120
     gggctgatcc aggcgttcaa gaccggcgac ggtttcggct tcgacaactt cgcccgcatg       180
     gccgccgacc cgttcttctg gcccgccgtg cgcaacacgc tgctgctgat cgtcatcctc       240
     atcccggtgc agttcgcgct ggccctgggg atggcgctgc tgttgcgggc caagccgaaa       300
     ctgtcgggcc tgtacttcta catctgggcg atcccgctgg cggtgtccga cctggccgcg       360
     ggcctggtgt ggctgtcgat cttcaccgac cacggctacc tcaactcgtt tttgtcccac       420
     ctgggcatcg acggggtgaa ctggctttcc tacgacagca acacgtcgat gttcttcgcg       480
     gtgttcatcg ccgagctgtg gcgcgccacc tcgctggtgc tggtgatcgt ggtggccggg       540
     atgcagggca tccccaagga ctacgacgag gcggcgcagg tgttcggcgc ctcctactgg       600
     cagcggctgc ggcacgtcac gctgccgctg ctgcggccca gcctccaggt ggcgttgatc       660
     ctgcggacga tcctggcgtt ccagaccttc gcggtggcac aggccctgac cggacgcgac       720
     ttcccggtcc tggtcggtga gacctacaac tggtacgtcg cgctgcgcaa cccgagcgtg       780
     gcctccgcgc tggccctggt catcctcgcc atctcgatga tcaccgcgat cgtctacctg       840
     cgggcgctgc gcgatccgtc cgacaaagga ggcaagcgat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page