(data stored in SCRATCH zone)

EMBL: CP001778.PE174

CP001778.PE174       Location/Qualifiers
FT   CDS_pept        178952..180112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0177"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: scl:sce5432 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39897"
FT                   /db_xref="GOA:D3Q1P9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P9"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADD39897.1"
FT                   /translation="MERDAEAEPADTSTGGRWDPAGLVLTVLPALAAFAGGLAQLYWVL
FT                   LAGPVGTMRWVDIGCGAAACFVLLFRSRARTGIAIALAVVAAFAATGGVANMVALYGVA
FT                   RYRRLPVALAVGAADVLAGYCFWLVYPENNKLSLTLVVNVAIVAAIVAWGAMRQTQESL
FT                   LLSYRERAERAEREQRLRETQIRQAERTRIAREMHDVVTHRISLVALHAGGLMVDPEPK
FT                   IDVVRGSAELIYGSARQALEELRLALGALRADEPTSLEQPGLDRIQDLVEDALRAGQEV
FT                   ELDMDPAIVETAPPGIGRDAYRFVQEGLANVRKHAPNAVAVVTVAAADGVLRVRVVNEM
FT                   VDGSLGVPGAGAGLIGLRERADLAGGTLSHGPVDGRFELVGELPWT"
     atggaacgcg acgccgaggc cgagcccgct gacacctcga cggggggtcg gtgggatccg        60
     gctgggcttg ttctcaccgt gctgcccgcg ctggctgctt ttgccggggg gctggcgcag       120
     ttgtattggg tgctgctggc cgggcccgtg gggacgatgc gttgggtcga tatcgggtgt       180
     ggggcggcgg cgtgtttcgt gttgctgttt cggagtcgcg ccaggaccgg gatcgcgatc       240
     gcgttggccg ttgtcgccgc gttcgccgct accgggggtg tggcgaatat ggtggcgctt       300
     tacggggtgg cccggtatcg gcggttgccg gtggcgttgg ccgtgggggc cgcggatgtg       360
     ttggccgggt attgcttttg gcttgtttat ccggagaaca acaagttgtc gctgacgttg       420
     gtcgtgaatg tcgcgattgt ggccgcgatc gtggcttggg gggcgatgcg gcagacgcag       480
     gagtcgttgt tgttgtcgta tcgcgagcgg gccgagcgcg cggaacggga gcagcggttg       540
     cgggagactc agattcggca ggcggagcgg acccggatcg ctcgggagat gcatgatgtt       600
     gttacgcacc ggatttcgct ggtcgcactg catgccgggg ggttgatggt cgatccggag       660
     ccgaagatcg atgttgttcg cggttcggcc gagttgatct atggttccgc gcggcaggcg       720
     ttggaggagt tgaggttggc gcttggggct ttgcgggcgg acgagccgac ttcgcttgag       780
     cagcccgggt tggatcggat tcaggatctg gtcgaggacg cgctgcgggc cgggcaggag       840
     gtggagttgg acatggatcc ggctatcgtc gagacggcgc caccgggtat tggccgcgac       900
     gcctatcgtt tcgtccagga aggactcgcc aatgtccgta agcacgcacc gaacgctgtc       960
     gccgtggtga cggtggccgc cgccgatggg gtgttgcggg tgcgggtggt caacgagatg      1020
     gtggacgggt cgttgggggt gccgggggcc ggggcggggt tgatcgggtt gcgggaacgt      1080
     gctgatctgg ctggcgggac gttgagccac gggccggttg acgggcgttt cgagctggtg      1140
     ggggaactgc cgtggacgtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page