(data stored in SCRATCH zone)

EMBL: CP001778.PE179

CP001778.PE179       Location/Qualifiers
FT   CDS_pept        complement(183522..183935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39902"
FT                   /db_xref="GOA:D3Q1Q4"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39902.1"
FT                   /translation="MSDSKSTGLKLVPRSRATVATLAGLLVGIIGILMQYAVTPEKFPG
FT                   FPPGVYVIGGCGVLVWLMQRLSWGTLPAILVTLQIIVLGGFIQGELTKNLQSSNTMTVI
FT                   ANLVLLVGMVFATVTAVVAIRRNLRDRARRQAA"
     atgagcgact cgaagagcac cggattgaaa ctcgtcccgc gttcccgcgc gacagtggcc        60
     acattggccg gactgttggt gggcatcatc ggcatcctga tgcagtacgc cgtcacgccc       120
     gagaagttcc ccggcttccc gccgggcgtc tacgtcatcg gcggctgcgg cgtgctggtg       180
     tggctgatgc agcgactgtc gtggggcacc ctgcccgcca tcctggtcac gctgcagatc       240
     atcgtcctgg gtggattcat ccagggtgag ctgacgaaga acctgcagtc gtcgaacacg       300
     atgaccgtga tcgcgaacct ggttctgttg gtgggcatgg tgttcgccac cgtcaccgcc       360
     gtcgtcgcga tccggcggaa cctccgcgac cgggcccgtc gccaggccgc gtga             414
//

If you have problems or comments...

PBIL Back to PBIL home page