(data stored in SCRATCH zone)

EMBL: CP001778.PE188

CP001778.PE188       Location/Qualifiers
FT   CDS_pept        complement(197247..202991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0192"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   Methyltransferase type 11; Methyltransferase type 12;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: mxa:MXAN_3779 non-ribosomal peptide
FT                   synthetase/polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39911"
FT                   /db_xref="GOA:D3Q1R3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R3"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADD39911.1"
FT                   /translation="MDISALTEEQRSRLAALRAGKAGARPEGIKPTGATRAALSAGQQR
FT                   IWFLSRFLPDTSAYNIVGSYRVRGEVSLTALQKTVDTLVARHASLRTRFIVDGDTPAQV
FT                   VEPQAVVKVRLDTADEGELDVRLDAFGRELFDLETGPLLRVLLTRTGPGEAVLSIAIHH
FT                   IIADGWSLGVFIGEFTAVYRQHLHGTDADLKPIPISYVDYSLWQRSREGTPEHKEQLSW
FT                   WMEALSHNPKVLELPTDRPRPAVQTFNGSRHRFAVSAAVRADVERLAREHATTPFAVLL
FT                   TAFSAVLRRWSGERRLNCATPVANRSRVETESVIGFFVNTVVLPMDLTGEPSFAELLDR
FT                   VKRVCLDSFSRQELPFEQLVDALSLDRTLSHNPLAQVMFILQSAPAGDLDLAGASLESI
FT                   DTETGTTKFDVTMEFFPAAAGYTGVIEYATDLFDAATAERLAVHYDQMLRAMLADPHGS
FT                   VATAPMLSASEREQLAAWNATEADTELGRRITDVVADRVREQPDAIAVSGDGVHLTRGE
FT                   LSDAAGRIANLLRGIGIDSDGLVGLCLRRGPHLVPSILGTLASGGAYVPFDPEQPPARV
FT                   AQMVRDGGIGIVVTTEDDRGALVDLPDTVTVLSLDAPATIAALAEQDTGWPQVAASDRD
FT                   LAYVIHTSGSTGTPKGVMVEHRAAMNRINWMQREYRLAESDRVMQKTTYTFDVSVWEFL
FT                   WPLMHGAAIVLATPDAHREPERLLDEITRHRVTHIHFVPTALSALLAHGSLAESSLRRI
FT                   FTSGDALPRDLCERVEADCGIAIDNLYGPTECAIDVTYWAWRPDVAGPPPIGHPVANTR
FT                   AHVVDEHGNELPVGVPGELWIGGVQVARGYLNRPDLTAERFRPDPFGGDGERVYRTGDL
FT                   VRRRADGALDFLGRIDDQVKVRGFRIELGEVEAALNRQPEVAEAAVLCRVDASGDKQLL
FT                   GFVVPDAGHLDTGEATVPWSDVFDQAYTDGDDPEDPEFNLKGWQSSYSKKPIPVDEMSA
FT                   WHADAVAKITATRPRRILEIGCGTGLFAFKLARGCEHYTGIDVSAEGLDYIAAQLPKLG
FT                   LTDKVSLHRLAADELSALDGQTFDCVVINSVAQYFPDRDYLDAVLASAATLLAPEGTIF
FT                   LGDIRNLGITAMFHDSVVRHQNPDTDEAVLTARAERQFAEETELLIHPAYFTTLPQRIP
FT                   GLRWAETSVKYSHGDNQLVRYRYDVTLHTEGEPIPVTEFGHWENLDRLTEQLASGVDGD
FT                   YLAVAGIPNARLHPDGVQPARLRELAEGTGLEALVTWSPSGAPGSLAVVYHHPGTRVTV
FT                   PHVSDEPDTNTPASGWAWRDLPRALRQRLRDILPDYMVPSMLVPLRRMPVSATGKVDRS
FT                   VLERIPDLRQISRGHTPPRTATERLVAEIFAAVLNVPEVTCEDNFFDLGGDSIKITQVA
FT                   VRLRDAGHPVMIRSIFANQTVELLATFLDTDTTAPTVAASPARVRDLPSGSFPASPLQE
FT                   HMMSVAPERTSNGMYVVQRVLRYQGEFDPDAAREAWHATVAATPFLRTVLRRSGDGFTQ
FT                   SPEANVDGSITALDWSGLDDDAKTEAIAEFLRTDRETGFDPATSLPTRFAFIRLGERHG
FT                   CWVISMDYRRLDGWSFTTYLGDFLAAYHRPGETGAKRRAPFDYASYVEWREERMRDGSV
FT                   ADWWRERLTSMSPIPVPPANRLSHRDFNVLITTVDAQAARGFHAACRAAGVTAAAGVQA
FT                   LWGAVTQRLDGHAAPRFGLTTAGRPAELPGIETALGMFMNTLPTTWRAGPADAVRDWMT
FT                   GAAESSLDLIDHGMIPQPELVRMAGLNEGEALFDTYLVFQNAPSADTGEDEHEQGFELI
FT                   DETPAAYSQQEHRLRLDVFPFEGRLHLSLSGYEPPARLREYLALLASGVIAMDAAAVDR
FT                   PMSTVLDADVAVPPLLDTDGLVTAMVLNAEAPQRKEETDE"
     gtggacatct ccgcactcac cgaggaacag cgttcccggc tggccgcgct gcgcgcgggc        60
     aaggccgggg cgcggccgga gggcatcaaa cccaccggcg ccacccgcgc cgcgctgtcg       120
     gccgggcagc agcggatctg gttcctgtcg cggttcctgc ccgacaccag cgcttacaac       180
     atcgtgggaa gctaccgggt gcgcggcgag gtatccctca ccgcgctgca gaagacagtg       240
     gacacgttgg tggcgcggca cgcgtcgctg cgcacccggt tcatcgtgga cggtgacact       300
     ccggcacagg tggtggagcc gcaggcggtc gtgaaggtgc ggctggacac cgccgacgag       360
     ggcgagctgg acgtccggct cgacgcgttc ggacgggagt tgttcgacct ggagaccgga       420
     ccgctgctgc gggtgctgct caccaggact gggccgggcg aggcggtgct gtcgatcgcg       480
     atccatcaca tcatcgccga cggctggtcg ctgggcgtgt tcatcggcga gttcaccgcc       540
     gtgtaccgac agcacctgca cggcaccgac gccgacctga agccgatccc gatcagctat       600
     gtggactatt cactgtggca gcggtcccgg gagggcactc cggagcacaa ggagcagctg       660
     tcgtggtgga tggaggcgtt gtcgcacaac ccgaaggtgc tggagctgcc caccgaccgg       720
     ccgcgtcccg ccgtgcagac cttcaacggg tcccggcacc ggttcgcggt gtcggcggcg       780
     gtgcgcgcgg acgtggagcg gctggcccgc gagcacgcga ccacgccgtt cgcggtgctg       840
     ctgacggctt tcagcgcggt gctgcgccgc tggagcggtg agcggcggtt gaactgcgcc       900
     accccggtgg ccaaccgttc ccgggtggag accgagtcgg tgatcgggtt cttcgtcaac       960
     acggtggtgc tgccgatgga tctcaccggt gagccgtcgt tcgccgagtt gctggaccgg      1020
     gtcaagcggg tgtgcctgga ttcgttctcg cggcaggagc tgccgttcga gcagctggtg      1080
     gacgcgctgt cgctggatcg gacgctgtcg cacaatccgt tggcgcaggt gatgttcatc      1140
     ctgcagagcg ctccggccgg tgacctggat ctggcgggcg cgtcgctgga gtcgatcgac      1200
     accgagaccg gcacgacgaa gttcgacgtc acgatggagt tcttccccgc ggcggcgggc      1260
     tacacggggg tcatcgagta cgccaccgac ctgttcgacg cggccaccgc cgagcgactt      1320
     gccgtccact atgaccagat gttgcgggcg atgctcgccg acccgcatgg atcggtggcc      1380
     acggcaccga tgctgtcggc ttcggagcgg gaacagctcg cggcctggaa cgcgaccgag      1440
     gccgacaccg aactggggcg gcggatcacc gatgtcgtcg ccgaccgggt gcgtgagcag      1500
     cccgacgcga tcgccgtgtc gggtgacggc gtccacctca ctcggggaga gctgtccgat      1560
     gccgccgggc gcatcgcgaa cctgttgcgc ggcatcggca tcgactccga cggcctggtg      1620
     gggctctgtc tgcgacgggg cccgcatctc gtgccgtcca tcctgggcac gctggcctcc      1680
     ggtggcgcct atgtgccctt cgatcccgag cagccacccg cgcgggtcgc gcagatggtc      1740
     cgcgacggcg gcatcggcat cgtcgtgacc actgaggacg atcgtggcgc gctggtggac      1800
     ctgcccgaca ccgtgaccgt cctgagcctc gacgccccgg ccacgatcgc cgccctcgcg      1860
     gaacaagaca ccggctggcc gcaggtcgcc gcatccgacc gcgacctcgc ctacgtcatc      1920
     cacacctccg gctccaccgg aacccccaag ggcgtcatgg tcgagcaccg cgcggcgatg      1980
     aaccggatca actggatgca gcgcgagtac cggctcgccg agagcgaccg ggtgatgcag      2040
     aagaccacct acaccttcga cgtgtcggtg tgggaattcc tgtggccctt gatgcacggc      2100
     gccgcgatcg tgctggccac cccggacgcg caccgggaac cggagcggct gctcgacgag      2160
     atcacccggc accgcgtcac ccatatccac ttcgtaccga cggcgttgtc ggcactgctg      2220
     gcgcacggca gcctcgccga atcctcgttg cgccggatct tcaccagcgg cgacgccctg      2280
     ccgcgcgacc tgtgcgaacg cgtcgaggct gactgcggca tcgcgatcga caacctctac      2340
     ggccccaccg aatgcgccat cgacgtcacc tactgggcct ggcggcccga cgtcgccggt      2400
     ccgccgccga tcgggcatcc ggtggccaac acccgcgcgc atgtcgtcga cgaacacggc      2460
     aacgagctcc ccgtgggtgt cccgggggaa ctgtggatcg gcggcgtgca ggtcgcgcga      2520
     ggctacctga accgtcccga cctgaccgcc gagcgattcc gccccgaccc gttcggcggc      2580
     gacggtgagc gcgtctatcg caccggtgac ctggtgcggc gccgcgccga cggcgcgctg      2640
     gacttcctgg gccgcatcga cgatcaggtc aaggtccgtg gtttccgtat cgagctcggc      2700
     gaggtggagg cggccctgaa ccggcagccc gaggtcgccg aggccgcggt gctgtgtcgc      2760
     gtggacgcgt ccggcgacaa gcagctgctg ggcttcgtgg tccccgacgc cgggcacctg      2820
     gacaccggcg aggcgaccgt cccgtggtcg gacgtcttcg accaggccta caccgacggc      2880
     gacgaccccg aggaccccga gttcaacctg aagggctggc agtccagcta cagcaagaaa      2940
     ccgatcccgg tggacgagat gtcggcgtgg cacgccgacg cggtcgcgaa gatcaccgcc      3000
     acccggccgc gccgcatcct cgagatcggt tgcggcaccg ggcttttcgc gttcaagctg      3060
     gcgcgcggct gcgagcacta caccggtatc gacgtctcgg ccgagggcct tgactacatc      3120
     gccgcgcagc tgccgaagct cggcttgacc gacaaggtgt cgctgcaccg gctggccgcc      3180
     gacgaactgt cggcactgga cggtcagacc ttcgactgcg tcgtcatcaa ctcggtggcg      3240
     cagtacttcc ccgaccgcga ctacctggac gcggtgctgg cgtccgccgc cacgctcctg      3300
     gcaccggagg ggacgatatt cctgggcgac atccgcaacc tcggcatcac cgcgatgttc      3360
     cacgattccg tggtgcggca ccaaaacccc gacaccgacg aggccgttct gaccgcgcgg      3420
     gccgaacggc agttcgccga ggagaccgaa ctgctcatcc acccggccta cttcaccacg      3480
     ctcccacaac gcatcccggg actgcgctgg gccgagacca gcgtcaagta ctcgcacggc      3540
     gacaaccagc tggtccgcta ccgctacgac gtcacgctgc acaccgaggg cgaaccgatc      3600
     cccgtcaccg agttcggcca ctgggagaac ctcgaccgac tgaccgaaca gctcgcgtcc      3660
     ggtgtggacg gcgactacct cgcggttgcg ggaatcccca acgcgcggct tcaccccgac      3720
     ggcgtccagc ccgcgagact gcgggaactg gccgagggca ccggcctgga agccctcgtc      3780
     acctggtcgc cgagcggcgc gccgggcagt ctggccgtcg tctaccacca cccgggcacg      3840
     cgggtcaccg tcccgcacgt cagcgacgaa cccgacacca acacccccgc gtcgggttgg      3900
     gcatggcggg acctgccgcg cgcgctgcgg cagcggctgc gcgacatcct gcccgactac      3960
     atggttccgt cgatgctggt tccgttgcgg cgcatgccgg tcagcgccac cggcaaggtg      4020
     gatcgttcgg tgctggagcg gatccccgac ctgcggcaga tctcgcgcgg acacactcca      4080
     cccaggacgg ccaccgagcg gctggtcgcc gagatcttcg ccgccgtcct gaacgtcccc      4140
     gaggtgacct gcgaggacaa tttcttcgat ctgggcggcg acagcatcaa gatcacccag      4200
     gtcgcggtgc ggctacgcga cgccgggcat ccggtgatga tccggtcgat cttcgccaac      4260
     cagaccgtgg aactgctggc gacgttcctg gacaccgaca cgaccgcacc aactgtggcg      4320
     gcctcgcccg cgcgggtccg cgacctgccc agcggcagct tccccgcctc gccgctccag      4380
     gaacacatga tgagcgtcgc gccggagcgg acgtccaacg gaatgtatgt ggtgcaacgg      4440
     gttctgcgtt accagggcga gttcgacccc gacgccgccc gcgaggcgtg gcacgccacg      4500
     gtggccgcca cgccgttcct gcgcaccgtg ctgcgccgaa gcggtgacgg tttcacgcag      4560
     agccccgaag ccaacgtgga cggttcgatc accgcactgg actggtccgg tctcgacgac      4620
     gacgccaaga ccgaggccat cgccgagttc ctgcgcaccg accgggaaac cggattcgac      4680
     cccgccacca gtctgccgac ccggttcgcg ttcatccggc tgggcgagcg gcacggctgc      4740
     tgggtgatca gcatggacta ccggcgcctc gacggctgga gcttcaccac ctacctgggc      4800
     gacttcctgg ccgcgtacca ccgacccggc gaaacggggg ccaagcggcg agcacccttc      4860
     gactacgcgt cgtatgtgga gtggcgagaa gagcggatgc gcgacggcag cgtcgcggac      4920
     tggtggcggg agcggttgac gtcgatgtcg ccgatcccgg tgccacccgc gaaccggctg      4980
     tcgcaccgcg acttcaacgt cctcatcacc acggtggacg cccaagccgc gcgcggtttc      5040
     cacgccgcct gccgcgcggc cggtgtcacc gcagccgcgg gcgtacaagc gctgtgggga      5100
     gcggtgaccc agcgcctcga cggccacgcc gcgccgcggt tcgggctgac cacggcgggg      5160
     cgtcccgccg aactgcccgg catcgagacc gcgctgggca tgttcatgaa cacgctgccg      5220
     acgacctggc gggccgggcc cgccgatgcc gtccgcgact ggatgacagg cgcggccgaa      5280
     agttcgctcg acctgatcga ccacggcatg atcccgcaac ccgagctggt ccgaatggcg      5340
     ggcctaaacg agggcgaggc cctgttcgac acctatctgg tgttccagaa tgcgcccagc      5400
     gccgacaccg gcgaggacga acacgagcag ggcttcgaac tcatcgacga gaccccggcg      5460
     gcgtactcgc agcaggagca ccggctgcgg ctcgacgtgt tcccgttcga ggggcggctg      5520
     cacctcagcc tgtccggcta cgagccgccc gcgcggctgc gggaatacct ggcgttgttg      5580
     gccagcggtg tcatcgccat ggacgcggcg gctgtcgacc gtccgatgag caccgtcctg      5640
     gacgccgacg tggcggtgcc gccattgctc gacaccgacg gcctggtcac ggcgatggtg      5700
     ctcaacgccg aagccccgca acggaaagag gaaaccgatg aatga                      5745
//

If you have problems or comments...

PBIL Back to PBIL home page