(data stored in SCRATCH zone)

EMBL: CP001778.PE193

CP001778.PE193       Location/Qualifiers
FT   CDS_pept        complement(211220..212146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39916"
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39916.1"
FT                   /translation="MRQAARRLREALTDEQADAAFHPFADADRTRWDYRPRPRPGACIG
FT                   EFGLTGRKRAHQLLATAMSPHAFAQITTIMGLEEVLDRAESWRRGRHSDDFWIAVFGSP
FT                   EDEAWAWRFEGHHVSVSMTVVAEEVSPTPVFLGANPASVDYRGTPVVRPLAIEEELARD
FT                   LLARLPDRQRAQAIVSPVAPSDIRTGNARDITDIDRWPGLRAADLSRGNAEILDRLIDV
FT                   YLDRLPPSLAAAERAVIEPDAIHFAWEGSAERGGGHYYRLQSPRLLIEYDNTQNDANHV
FT                   HTVLRRPGDDFGRGLLPSHVASEREPR"
     atgcgccagg ccgcgcggcg actgcgcgag gccctcaccg acgagcaggc cgacgccgcc        60
     ttccacccgt tcgccgacgc ggaccggacg cggtgggact accgtccccg gccccgtccc       120
     ggcgcgtgta tcggcgagtt cgggctcacc ggccgcaaac gcgcgcacca gctgctggcc       180
     accgcgatga gcccgcacgc cttcgcgcag atcacgacga tcatgggcct ggaggaggtg       240
     ctcgaccgcg ccgagtcctg gcggcggggc cgtcacagcg acgacttctg gatcgccgtg       300
     ttcggttcgc ccgaggacga ggcgtgggcg tggcggttcg aggggcacca cgtctcggtc       360
     agcatgacgg tcgtggccga ggaggtcagt ccgacgccgg tgttcctggg cgccaacccc       420
     gccagcgtcg actaccgggg gacgccggtg gtgcgtccat tggccattga ggaggagctg       480
     gcgcgggatc tgttggcgcg gttgcccgac cggcagcgcg cccaggcgat cgtgtcgccg       540
     gtcgcgccgt ccgacatccg caccggcaac gcccgcgaca tcaccgacat cgaccggtgg       600
     ccgggactgc gggccgccga cctgtcgcgc ggcaacgccg agatcctgga ccggctcatc       660
     gacgtgtacc tggaccggct gccgccgtcg ctggccgccg ccgaacgggc cgtcatcgaa       720
     cccgacgcga tccacttcgc ctgggagggt tcggccgaac gcggcggcgg ccactactac       780
     cggctgcagt cgccgcggct gctcatcgag tacgacaaca cccagaacga cgccaaccac       840
     gtccacaccg tcctgcggcg tcccggcgac gacttcggac ggggactgct tccgtcgcat       900
     gtggcctcgg agcgcgaacc ccggtaa                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page