(data stored in SCRATCH zone)

EMBL: CP001778.PE194

CP001778.PE194       Location/Qualifiers
FT   CDS_pept        212236..212586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0198"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: sit:TM1040_3855
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39917"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R9"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADD39917.1"
FT                   /translation="MRYMLLIYGCDRPEPDDPKFAEAMASINAFAEECRRRGVLEAGEP
FT                   LKRPETATTVRVREGQTLMTDGPFAETHEHLGGYYIIDCQNLDEALELAAMCPFAAEGT
FT                   IEVRPLEADVAP"
     atgcgataca tgctgttgat ctacggctgc gaccgccccg agccggacga tccgaaattc        60
     gccgaggcga tggcctcgat caacgccttc gccgaggagt gccgccgccg cggcgtcctg       120
     gaggcgggcg aaccgctgaa acgacccgag accgccacca cggtgcgagt gcgcgagggc       180
     cagaccctga tgaccgacgg acccttcgcc gagacccacg aacacctcgg cggctactac       240
     atcatcgact gccagaacct ggacgaggcg ctggaactgg ccgcgatgtg cccgttcgcg       300
     gccgagggca ccatcgaggt ccgcccgctt gaggctgacg tcgccccatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page