(data stored in SCRATCH zone)

EMBL: CP001778.PE197

CP001778.PE197       Location/Qualifiers
FT   CDS_pept        complement(214530..215558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0201"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: psp:PSPPH_2128 ribose operon
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39920"
FT                   /db_xref="GOA:D3Q1S2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1S2"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD39920.1"
FT                   /translation="MRSRLKDVAQRAGVSIKTVSNVVHGYQHVRADTRQRVEQAIADLQ
FT                   YRPNLSARSLRAARSGVIALALPEMDAPYFAELARHVVAEAEEHGWTVLIDQTEGSRER
FT                   ERVVTGGIRSELIDGLIFSPLALTAEDLAERTDSTPMVLLGERITGSPPIADHVLVDNV
FT                   AAAREATEHLLGLGRRRIAAIGAQRTPAGVTARLRLRGYRQALRQADVATDDTLIQGAS
FT                   QYRRAHGAEAMARLLERDDPPDAVFCFNDLLALGALRTLLQRGIRVPEDVALVGFDDIE
FT                   DGRFSTPTLTTIRPDKARIGALSVDMLAQRLSGDLKGPPRESYVGYELVVRESTAGAEP
FT                   VA"
     atgcgatcgc gcctgaagga cgtggcccag cgggccggcg tctcgatcaa gaccgtgtcc        60
     aatgtggttc acggatatca gcacgtccgc gccgacaccc ggcagcgggt ggagcaggcg       120
     atcgccgatc tccagtaccg ccccaacctg tccgcgcgca gcctgcgggc cgcgcgctcc       180
     ggtgtcatcg cgctggcact gcccgaaatg gacgcacctt atttcgccga gctggcccgg       240
     cacgtcgtcg ccgaggccga ggaacacggc tggaccgtcc tcatcgacca gaccgagggc       300
     tcgcgggagc gcgaacgcgt cgtcaccggc ggcatccgca gcgaactcat cgacggcctg       360
     atcttcagcc cgctggcgct gaccgccgag gacctcgccg aacgcaccga ctccaccccg       420
     atggtgctgc tgggcgaacg catcaccggt tcgccgccga tcgccgacca cgtgctcgtc       480
     gacaacgtcg ccgccgcccg cgaggccacc gagcacctgc tgggcctggg tcgccgccgg       540
     atcgcggcca tcggcgccca gcgcaccccg gcgggcgtca ccgcgcggct gcggctgcgc       600
     ggctaccggc aggcgctgcg gcaggcggac gtcgccaccg acgacaccct gatccagggc       660
     gcctcccagt accgccgcgc ccacggcgcc gaggcgatgg cccggctgct ggaacgcgac       720
     gacccacccg acgcggtgtt ctgcttcaac gacctgctgg cgctgggggc gctgcgaacc       780
     ctgctgcaac gcggcatccg ggtgcccgag gacgtcgccc tggtcggctt cgacgacatc       840
     gaggacggca ggttctccac gccgacgctg acgaccatcc gccccgacaa ggcccgcatc       900
     ggcgcgctgt cggtggacat gttggcgcag cggctcagcg gcgacctgaa gggaccgccc       960
     cgggagagct acgtgggtta cgaactcgtg gtgcgggaat ccacggccgg ggccgaaccg      1020
     gtcgcctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page