(data stored in SCRATCH zone)

EMBL: CP001778.PE226

CP001778.PE226       Location/Qualifiers
FT   CDS_pept        245292..245846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0230"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mlr0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39949"
FT                   /db_xref="GOA:D3Q2X9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2X9"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADD39949.1"
FT                   /translation="MARLVYSAIMSLDGYIADENGEFGWAMPSDEVHGFINDRMRSIGT
FT                   HLYGRVLYETMTGWETDPSLAEQPLGRDFAEQWQAADKIVYSTTLDKPVTAKTRIEREF
FT                   DPVVVQGLKDTAEADLLIGGPVLAAHAFAAGLVDVCELYVVPVIVGGGHLGLPEGLFLN
FT                   LELLEERRFANGFVLLRYKVG"
     atggccagat tggtctattc cgcgatcatg tcactggacg gctacatagc cgacgagaac        60
     ggggaattcg gctgggcgat gccctccgac gaggttcacg gcttcatcaa cgaccgcatg       120
     cgttccatcg gcacccacct gtacggccgg gtgctctacg agacgatgac cggctgggag       180
     accgacccgt ccctggccga acaaccgctg ggccgtgact tcgccgagca gtggcaggcc       240
     gcggacaaga tcgtctactc caccaccctc gacaagcccg tcaccgcgaa gacccgcatc       300
     gagcgcgagt tcgacccggt ggtggtccag ggcctgaagg acaccgccga agccgacctc       360
     ctcatcggcg gcccggtact tgccgcccat gccttcgcgg ccggactggt cgacgtgtgc       420
     gagctgtacg tcgtcccggt gatcgtcggc ggcggccacc tgggcctgcc ggagggcctg       480
     ttcctgaacc tggaactgct ggaggaacga cgcttcgcga acggtttcgt gctgttgcgc       540
     tacaaggtgg gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page